Gpm6a (BC023461) Mouse Tagged ORF Clone

CAT#: MR203545

Gpm6a (Myc-DDK-tagged) - Mouse glycoprotein m6a (cDNA clone MGC:32434 IMAGE:5041793)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 98.00

USD 670.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Gpm6a (BC023461) Mouse Tagged ORF Clone
Symbol Gpm6a
Synonyms MGC38999, M6A
Vector pCMV6-Entry
Sequence Data
>MR203545 representing BC023461
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGTGCTTCGAGTGCTGCATTAAATGCCTGGGAGGTATTCCCTATGCTTCTCTGATTGCAACCATCC
TGCTGTATGCAGGCGTTGCCCTGTTCTGTGGCTGTGGCCATGAAGCCCTTTCTGGAACAGTCAACATTCT
GCAGACCTACTTTGAGTTGGCAAGGACTGCTGGAGACACACTGGATGTTTTCACTATGATTGACATCTTT
AAGTATGTGATCTATGGCATTGCGGCTGCTTTCTTTGTCTATGGCATTTTACTGATGGTAGAAGGTTTCT
TCACAACTGGGGCTATCAAAGATCTCTATGGAGACTTCAAAATCACCACCTGTGGCAGATGTGTGAGCGC
TTGGTTTATCATGCTGACATACCTCTTCATGTTGGCCTGGCTGGGAGTCACAGCTTTCACCTCACTGCCC
GTGTACATGTATTTCAATGTGTGGACCATCTGCCGGAACACCACTCTAGTGGAGGGAGCAAATCTCTGCT
TGGATCTGCGTCAGTTTGGGATTGTGACAATTGGAGAGGAAAAGAAAATTTGTACTGCCTCTGAGAACTT
CCTGAGGATGTGTGAATCTACTGAGCTGAATATGACCTTCCACTTGTTCATTGTGGCACTTGCTGGAGCT
GGAGCAGCAGTTATTGCTATGGTCCACTACCTGATGGTTCTGTCTGCCAACTGGGCCTATGTGAAAGATG
CCTGCCGCATGCAGAAGTACGAAGACATCAAGTCAAAGGAAGAGCAGGAGCTGCACGACATCCATTCTAC
TCGCTCTAAAGAGCGGCTCAATGCGTACACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203545 representing BC023461
Red=Cloning site Green=Tags(s)

MGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQTYFELARTAGDTLDVFTMIDIF
KYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLAWLGVTAFTSLP
VYMYFNVWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTASENFLRMCESTELNMTFHLFIVALAGA
GAAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN BC023461
ORF Size 801 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC023461
RefSeq Size 2780
RefSeq ORF 803
Locus ID 234267
Cytogenetics 8|8 B1.3
MW 101.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)