Tnni3 (NM_009406) Mouse Tagged ORF Clone

CAT#: MR202282

Reviews ()
Write a review
  • TrueORF®

Tnni3 (Myc-DDK-tagged) - Mouse troponin I, cardiac 3 (Tnni3)



  "NM_009406" in other vectors (4)

Interest in protein/lysate? Submit request here!

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 305.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Tnni3
Synonyms cTnI; Tn1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR202282 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGATGAGAGCAGCGATGCGGCTGGGGAACCGCAGCCTGCGCCTGCTCCTGTCCGACGCCGCTCCT
CTGCCAACTACCGAGCCTATGCCACCGAGCCACACGCCAAGAAAAAGTCTAAGATCTCCGCCTCCAGAAA
ACTTCAGTTGAAGACTCTGATGCTGCAGATTGCGAAGCAGGAGATGGAACGAGAGGCAGAAGAGCGACGT
GGAGAGAAGGGGCGCGTTCTGAGGACTCGTTGCCAGCCTTTGGAGTTGGATGGGCTGGGCTTTGAAGAGC
TTCAGGACTTATGCCGACAGCTTCACGCTCGGGTGGACAAAGTGGATGAAGAGAGATATGACGTGGAAGC
AAAAGTCACCAAGAACATCACTGAGATTGCAGATCTGACCCAGAAGATCTATGACCTCCGTGGCAAGTTT
AAGCGGCCCACCCTCCGAAGAGTGAGGATCTCTGCAGATGCCATGATGCAGGCGCTGCTGGGGACCCGGG
CCAAGGAATCCTTGGACCTGAGGGCCCACCTCAAGCAGGTGAAGAAGGAGGACATTGAGAAGGAAAACCG
GGAGGTGGGAGACTGGCGCAAGAATATCGATGCACTGAGTGGCATGGAAGGCCGCAAGAAAAAGTTTGAG
GGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202282 protein sequence
Red=Cloning site Green=Tags(s)

MADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQEMEREAEERR
GEKGRVLRTRCQPLELDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKF
KRPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKEDIEKENREVGDWRKNIDALSGMEGRKKKFE
G

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_009406
ORF Size 636 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_009406.4
RefSeq Size 854 bp
RefSeq ORF 636 bp
Locus ID 21954
UniProt ID P48787
Cytogenetics 7 2.61 cM
MW 24.3 kDa
Gene Summary Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Tnni3"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Order online and get additional $20 off!