Ung (BC004037) Mouse Tagged ORF Clone

SKU
MR202000
Ung (Myc-DDK-tagged) - Mouse uracil DNA glycosylase (cDNA clone MGC:7655 IMAGE:3495894)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ung
Synonyms UNG1, UNG2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202000 representing BC004037
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC



ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202000 representing BC004037
Red=Cloning site Green=Tags(s)

MGFVAEERNHHKVYPPPEQVFTWTQMCDIRDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIFK
ELSTDIDGFVHPGHGDLSGWARQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNLSGLVFLLW
GSYAQKKGSVIDRKRHHVLQTAHPSPLSVYRGFLGCRHFSKANELLQKSGKKPINWKEL

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN BC004037
ORF Size 97 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC004037
RefSeq Size 1737 bp
RefSeq ORF 599 bp
Locus ID 22256
Cytogenetics 5 F
MW 63.7 kDa
Summary Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Ung (BC004037) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MG202000 Ung (tGFP-tagged) - Mouse uracil DNA glycosylase (cDNA clone MGC:7655 IMAGE:3495894) 10 ug
$530.00
MR202000L3 Lenti ORF clone of Ung (Myc-DDK-tagged) - Mouse uracil DNA glycosylase (cDNA clone MGC:7655 IMAGE:3495894) 10 ug
$630.00
MR202000L4 Lenti ORF clone of Ung (mGFP-tagged) - Mouse uracil DNA glycosylase (cDNA clone MGC:7655 IMAGE:3495894) 10 ug
$630.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.