Id2 (NM_010496) Mouse Tagged ORF Clone
CAT#: MR200792
- TrueORF®
Id2 (Myc-DDK-tagged) - Mouse inhibitor of DNA binding 2 (Id2)
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_010496" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Id2 |
Synonyms | AI255428; bHLHb26; C78922; Idb2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200792 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAAGCCTTCAGTCCGGTGAGGTCCGTTAGGAAAAACAGCCTGTCGGACCACAGCTTGGGCATCTCCC GGAGCAAAACCCCGGTGGACGACCCGATGAGTCTGCTCTACAACATGAACGACTGCTACTCCAAGCTCAA GGAACTGGTGCCCAGCATCCCCCAGAACAAGAAGGTGACCAAGATGGAAATCCTGCAGCACGTCATCGAT TACATCTTGGACCTGCAGATCGCCCTGGACTCGCATCCCACTATCGTCAGCCTGCATCACCAGAGACCTG GACAGAACCAGGCGTCCAGGACGCCGCTGACCACCCTGAACACGGACATCAGCATCCTGTCCTTGCAGGC ATCTGAATTCCCTTCTGAGCTTATGTCGAATGATAGCAAAGTACTCTGTGGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200792 protein sequence
Red=Cloning site Green=Tags(s) MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVID YILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_010496 |
ORF Size | 405 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_010496.3, NP_034626.1 |
RefSeq Size | 1289 bp |
RefSeq ORF | 405 bp |
Locus ID | 15902 |
UniProt ID | P41136 |
Cytogenetics | 12 8.57 cM |
MW | 15 kDa |
Gene Summary | Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Restricts the CLOCK and ARNTL/BMAL1 localization to the cytoplasm. Plays a role in both the input and output pathways of the circadian clock: in the input component, is involved in modulating the magnitude of photic entrainment and in the output component, contributes to the regulation of a variety of liver clock-controlled genes involved in lipid metabolism.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC207307 | Id2 (untagged) - Mouse inhibitor of DNA binding 2 (Id2), (10ug) |
USD 165.00 |
|
MG200792 | Id2 (tGFP-tagged) - Mouse inhibitor of DNA binding 2 (Id2) |
USD 350.00 |
|
MR200792L3 | Lenti ORF clone of Id2 (Myc-DDK-tagged) - Mouse inhibitor of DNA binding 2 (Id2) |
USD 450.00 |
|
MR200792L4 | Lenti ORF clone of Id2 (mGFP-tagged) - Mouse inhibitor of DNA binding 2 (Id2) |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review