Rac1 (NM_009007) Mouse Tagged ORF Clone

SKU
MG227648
Rac1 (tGFP-tagged) - Mouse RAS-related C3 botulinum substrate 1 (Rac1), (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rac1
Synonyms AL023026; D5Ertd559e
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG227648 representing NM_009007
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGCCATCAAGTGTGTGGTGGTGGGAGACGGAGCTGTTGGTAAAACCTGCCTGCTCATCAGTTACA
CGACCAATGCATTTCCTGGAGAGTACATCCCCACCGTCTTTGACAACTATTCTGCCAATGTTATGGTAGA
TGGAAAACCAGTGAATCTGGGCCTATGGGACACAGCTGGACAAGAAGATTATGACAGATTGCGTCCCCTC
TCCTACCCGCAGACAGACGTGTTCTTAATTTGCTTTTCCCTTGTGAGTCCTGCATCATTTGAAAATGTCC
GTGCAAAGTGGTATCCTGAAGTGCGACACCACTGTCCCAATACTCCTATCATCCTCGTGGGGACGAAGCT
TGATCTTAGGGATGATAAGGACACCATTGAGAAGCTGAAGGAGAAGAAGCTGACTCCCATCACCTACCCG
CAGGGGCTGGCCATGGCGAAAGAGATCGGTGCTGTCAAATACCTGGAGTGCTCAGCTCTCACACAGCGAG
GACTCAAGACAGTGTTTGACGAAGCTATCCGAGCGGTTCTCTGTCCCCCTCCTGTCAAGAAGAGGAAGAG
AAAATGCCTGCTGTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG227648 representing NM_009007
Red=Cloning site Green=Tags(s)

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL
SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYP
QGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_009007
ORF Size 576 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009007.2, NP_033033.1
RefSeq Size 2284 bp
RefSeq ORF 579 bp
Locus ID 19353
UniProt ID P63001
Cytogenetics 5 82.22 cM
Summary Plasma membrane-associated small GTPase which cycles between active GTP-bound and inactive GDP-bound states (PubMed:24352656). In its active state, binds to a variety of effector proteins to regulate cellular responses such as secretory processes, phagocytosis of apoptotic cells, epithelial cell polarization, neurons adhesion, migration and differentiation, and growth-factor induced formation of membrane ruffles. Rac1 p21/rho GDI heterodimer is the active component of the cytosolic factor sigma 1, which is involved in stimulation of the NADPH oxidase activity in macrophages. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. Stimulates PKN2 kinase activity. In concert with RAB7A, plays a role in regulating the formation of RBs (ruffled borders) in osteoclasts. In glioma cells, promotes cell migration and invasion. Required for atypical chemokine receptor ACKR2-induced LIMK1-PAK1-dependent phosphorylation of cofilin (CFL1) and for up-regulation of ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. In podocytes, promotes nuclear shuttling of NR3C2; this modulation is required for a proper kidney functioning. In neurons, is involved in dendritic spine formation and synaptic plasticity (PubMed:24352656, PubMed:26969129). In synapses, seems to mediate the regulation of F-actin cluster formation performed by SHANK3.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Rac1 (NM_009007) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MR227648 Rac1 (Myc-DDK-tagged) - Mouse RAS-related C3 botulinum substrate 1 (Rac1) 10 ug
$450.00
MR227648L3 Lenti ORF clone of Rac1 (Myc-DDK-tagged) - Mouse RAS-related C3 botulinum substrate 1 (Rac1) 10 ug
$750.00
MR227648L4 Lenti ORF clone of Rac1 (mGFP-tagged) - Mouse RAS-related C3 botulinum substrate 1 (Rac1) 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.