Mapk1 (NM_011949) Mouse Tagged ORF Clone

SKU
MG227633
Mapk1 (tGFP-tagged) - Mouse mitogen-activated protein kinase 1 (Mapk1) transcript variant 1, (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$657.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Mapk1
Synonyms 9030612K14Rik; AA407128; AU018647; C78273; ERK; Erk2; MAPK2; p41mapk; p42mapk; Prkm1; PRKM2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG227633 representing NM_011949
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCGGCGGCGGCGGGCCCGGAGATGGTCCGCGGGCAGGTGTTCGACGTAGGGCCGCGCTACA
CCAACCTCTCGTACATCGGAGAAGGCGCCTACGGCATGGTTTGCTCTGCTTATGATAATCTCAACAAAGT
TCGAGTTGCTATCAAGAAAATCAGTCCTTTTGAGCACCAGACCTACTGTCAAAGAACCCTAAGAGAGATA
AAAATCTTACTGCGCTTCAGACATGAGAACATCATTGGCATCAATGACATCATCCGGGCACCAACCATTG
AGCAAATGAAAGATGTATATATAGTACAGGACCTCATGGAGACGGACCTTTACAAGCTCTTGAAGACACA
GCACCTCAGCAATGACCACATCTGCTATTTTCTTTATCAGATCCTGAGAGGGCTAAAGTATATCCATTCA
GCTAACGTTCTGCACCGTGACCTCAAGCCTTCCAACCTCCTGCTGAACACCACTTGTGATCTCAAGATCT
GTGACTTTGGCCTTGCCCGTGTTGCAGATCCAGATCATGATCACACAGGGTTCTTGACAGAGTACGTAGC
CACACGTTGGTACAGAGCTCCAGAAATTATGTTGAATTCCAAGGGTTATACCAAGTCCATTGATATTTGG
TCTGTGGGCTGCATCCTGGCAGAGATGCTATCCAACAGGCCTATCTTCCCAGGAAAGCATTACCTTGACC
AGCTGAATCACATCCTGGGTATTCTTGGATCTCCATCACAGGAAGATCTGAATTGTATAATAAATTTAAA
AGCTAGAAACTATTTGCTTTCTCTCCCGCACAAAAATAAGGTGCCATGGAACAGGTTGTTCCCAAATGCT
GACTCCAAAGCTCTGGATTTACTGGATAAAATGTTGACATTTAACCCTCACAAGAGGATTGAAGTTGAAC
AGGCTCTGGCCCACCCATACCTGGAGCAGTATTATGACCCAAGTGATGAGCCCATTGCTGAAGCGCCATT
CAAGTTTGACATGGAGTTGGACGACTTACCTAAGGAGAAGCTCAAAGAACTCATTTTTGAAGAGACTGCT
AGATTCCAGCCAGGATACAGATCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG227633 representing NM_011949
Red=Cloning site Green=Tags(s)

MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREI
KILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHS
ANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIW
SVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNA
DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETA
RFQPGYRS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_011949
ORF Size 1074 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011949.3, NP_036079.1
RefSeq Size 5099 bp
RefSeq ORF 1077 bp
Locus ID 26413
UniProt ID P63085
Cytogenetics 16 10.53 cM
Summary Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, DCC, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade. Mediates phosphorylation of TPR in respons to EGF stimulation. May play a role in the spindle assembly checkpoint. Phosphorylates PML and promotes its interaction with PIN1, leading to PML degradation. Phosphorylates CDK2AP2 (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Mapk1 (NM_011949) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC209720 Mapk1 (untagged) - Mouse mitogen-activated protein kinase 1 (Mapk1), transcript variant 1, (10ug) 10 ug
$503.00
MR227633 Mapk1 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 1 (Mapk1), transcript variant 1 10 ug
$289.00 MSRP $457.00 MSRP $457.00
MR227633L3 Lenti ORF clone of Mapk1 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 1 (Mapk1), transcript variant 1 10 ug
$757.00
MR227633L4 Lenti ORF clone of Mapk1 (mGFP-tagged) - Mouse mitogen-activated protein kinase 1 (Mapk1), transcript variant 1 10 ug
$757.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.