Mapk14 (NM_001168508) Mouse Tagged ORF Clone

SKU
MG227412
Mapk14 (tGFP-tagged) - Mouse mitogen-activated protein kinase 14 (Mapk14) transcript variant 2, (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$657.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Mapk14
Synonyms Crk1; Csbp1; CSBP2; Mxi2; p38; p38-alpha; p38a; p38alpha; p38MAPK; PRKM14; PRKM15
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG227412 representing NM_001168508
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCAGGAGAGGCCCACGTTCTACCGGCAGGAGCTGAACAAGACCATCTGGGAGGTGCCCGAACGAT
ACCAGAACCTGTCCCCGGTGGGCTCGGGCGCCTATGGCTCGGTGTGTGCTGCTTTTGATACAAAGACGGG
GCATCGTGTGGCAGTTAAGAAGCTGTCGAGACCGTTTCAGTCCATCATTCACGCCAAAAGGACCTACCGA
GAGTTGCGTCTGCTGAAGCACATGAAACACGAAAATGTGATTGGTCTGTTGGATGTGTTCACACCCGCAA
GGTCACTGGAGGAATTCAATGACGTGTACCTGGTGACCCATCTCATGGGGGCGGACCTGAACAACATCGT
GAAGTGCCAGAAGCTGACCGACGACCACGTTCAGTTTCTCATCTACCAGATCCTCCGAGGGCTGAAGTAT
ATACATTCGGCTGACATAATTCACAGGGACCTAAAGCCCAGCAACCTAGCTGTGAACGAAGACTGTGAGC
TCAAGATTCTGGATTTTGGGCTGGCTCGGCACACTGATGATGAGATGACAGGCTACGTGGCTACCAGGTG
GTACCGAGCCCCAGAGATCATGCTGAATTGGATGCACTATAACCAGACAGTGGATATTTGGTCCGTGGGC
TGCATCATGGCTGAGCTGTTGACCGGAAGAACGTTGTTTCCTGGTACAGACCATATTAACCAGCTTCAGC
AGATAATGCGTCTGACGGGGACACCCCCTGCTTATCTCATTAACAGGATGCCAAGCCATGAGGCAAGAAA
CTACATTCAGTCTCTGGCCCAGATGCCGAAGATGAACTTCGCAAATGTATTTATTGGTGCCAATCCCCTG
GCTGTCGACCTACTGGAGAAGATGCTCGTTTTGGACTCAGATAAGAGGATCACAGCAGCCCAAGCTCTTG
CGCATGCCTACTTTGCTCAGTACCACGACCCTGATGATGAGCCTGTTGCTGACCCTTATGACCAGTCCTT
TGAAAGCAGGGACCTTCTCATAGATGAGTGGAAGAGCCTGACCTATGATGAAGTCATCAGCTTTGTGCCA
CCACCCCTTGACCAAGAAGAAATGGAGTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG227412 representing NM_001168508
Red=Cloning site Green=Tags(s)

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYR
ELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKY
IHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG
CIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPAYLINRMPSHEARNYIQSLAQMPKMNFANVFIGANPL
AVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVP
PPLDQEEMES

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001168508
ORF Size 1080 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001168508.1, NP_001161980.1
RefSeq Size 3560 bp
RefSeq ORF 1083 bp
Locus ID 26416
UniProt ID P47811
Cytogenetics 17 14.85 cM
Summary Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK14 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. Some of the targets are downstream kinases which are activated through phosphorylation and further phosphorylate additional targets. RPS6KA5/MSK1 and RPS6KA4/MSK2 can directly phosphorylate and activate transcription factors such as CREB1, ATF1, the NF-kappa-B isoform RELA/NFKB3, STAT1 and STAT3, but can also phosphorylate histone H3 and the nucleosomal protein HMGN1. RPS6KA5/MSK1 and RPS6KA4/MSK2 play important roles in the rapid induction of immediate-early genes in response to stress or mitogenic stimuli, either by inducing chromatin remodeling or by recruiting the transcription machinery. On the other hand, two other kinase targets, MAPKAPK2/MK2 and MAPKAPK3/MK3, participate in the control of gene expression mostly at the post-transcriptional level, by phosphorylating ZFP36 (tristetraprolin) and ELAVL1, and by regulating EEF2K, which is important for the elongation of mRNA during translation. MKNK1/MNK1 and MKNK2/MNK2, two other kinases activated by p38 MAPKs, regulate protein synthesis by phosphorylating the initiation factor EIF4E2. MAPK14 interacts also with casein kinase II, leading to its activation through autophosphorylation and further phosphorylation of TP53/p53. In the cytoplasm, the p38 MAPK pathway is an important regulator of protein turnover. For example, CFLAR is an inhibitor of TNF-induced apoptosis whose proteasome-mediated degradation is regulated by p38 MAPK phosphorylation. In a similar way, MAPK14 phosphorylates the ubiquitin ligase SIAH2, regulating its activity towards EGLN3. MAPK14 may also inhibit the lysosomal degradation pathway of autophagy by interfering with the intracellular trafficking of the transmembrane protein ATG9. Another function of MAPK14 is to regulate the endocytosis of membrane receptors by different mechanisms that impinge on the small GTPase RAB5A. In addition, clathrin-mediated EGFR internalization induced by inflammatory cytokines and UV irradiation depends on MAPK14-mediated phosphorylation of EGFR itself as well as of RAB5A effectors. Ectodomain shedding of transmembrane proteins is regulated by p38 MAPKs as well. In response to inflammatory stimuli, p38 MAPKs phosphorylate the membrane-associated metalloprotease ADAM17. Such phosphorylation is required for ADAM17-mediated ectodomain shedding of TGF-alpha family ligands, which results in the activation of EGFR signaling and cell proliferation. Another p38 MAPK substrate is FGFR1. FGFR1 can be translocated from the extracellular space into the cytosol and nucleus of target cells, and regulates processes such as rRNA synthesis and cell growth. FGFR1 translocation requires p38 MAPK activation. In the nucleus, many transcription factors are phosphorylated and activated by p38 MAPKs in response to different stimuli. Classical examples include ATF1, ATF2, ATF6, ELK1, PTPRH, DDIT3, TP53/p53 and MEF2C and MEF2A. The p38 MAPKs are emerging as important modulators of gene expression by regulating chromatin modifiers and remodelers. The promoters of several genes involved in the inflammatory response, such as IL6, IL8 and IL12B, display a p38 MAPK-dependent enrichment of histone H3 phosphorylation on 'Ser-10' (H3S10ph) in LPS-stimulated myeloid cells. This phosphorylation enhances the accessibility of the cryptic NF-kappa-B-binding sites marking promoters for increased NF-kappa-B recruitment. Phosphorylates CDC25B and CDC25C which is required for binding to 14-3-3 proteins and leads to initiation of a G2 delay after ultraviolet radiation. Phosphorylates TIAR following DNA damage, releasing TIA
Write Your Own Review
You're reviewing:Mapk14 (NM_001168508) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC209724 Mapk14 (untagged) - Mouse mitogen-activated protein kinase 14 (Mapk14), transcript variant 2, (10ug) 10 ug
$457.00
MR227412 Mapk14 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 14 (Mapk14), transcript variant 2 10 ug
$289.00 MSRP $457.00 MSRP $457.00
MR227412L3 Lenti ORF clone of Mapk14 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 14 (Mapk14), transcript variant 2 10 ug
$757.00
MR227412L4 Lenti ORF clone of Mapk14 (mGFP-tagged) - Mouse mitogen-activated protein kinase 14 (Mapk14), transcript variant 2 10 ug
$757.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.