Twist1 (NM_011658) Mouse Tagged ORF Clone

SKU
MG227370
Twist1 (tGFP-tagged) - Mouse twist homolog 1 (Drosophila) (Twist1), (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Twist1
Synonyms bHLHa; bHLHa38; M-Twi; M-Twist; pd; Pde; pdt; Pluri; Ska; Ska10; Ska<m10J; Ska<m10Jus>; Twist
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG227370 representing NM_011658
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGCAGGACGTGTCCAGCTCGCCAGTCTCTCCGGCCGACGACAGCCTGAGCAACAGCGAGGAGGAGC
CGGACCGGCAGCAGCCGGCGAGCGGCAAGCGCGGGGCTCGCAAGAGACGCAGCAGTCGGCGCAGCGCGGG
CGGCAGCGCGGGGCCCGGCGGGGCCACGGGCGGGGGCATCGGAGGCGGCGACGAGCCAGGCAGCCCGGCC
CAGGGCAAGCGCGGCAAGAAATCTGCGGGCGGAGGCGGCGGCGGCGGCGCGGGCGGAGGTGGTGGCGGCG
GCGGCGGCAGCAGCAGCGGGGGCGGGAGCCCGCAGTCGTACGAGGAGCTGCAGACCCAGCGGGTCATGGC
TAACGTGCGGGAGCGCCAGCGCACGCAGTCGCTGAACGAGGCGTTCGCCGCCCTGCGCAAGATCATCCCC
ACGCTGCCCTCGGACAAGCTGAGCAAGATTCAGACCCTCAAACTGGCGGCCAGGTACATCGACTTCCTGT
ACCAGGTCCTGCAGAGCGACGAGCTGGACTCCAAGATGGCAAGCTGCAGCTATGTGGCCCACGAGCGGCT
CAGCTACGCCTTCTCCGTCTGGAGGATGGAGGGGGCCTGGTCCATGTCCGCGTCCCAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG227370 representing NM_011658
Red=Cloning site Green=Tags(s)

MMQDVSSSPVSPADDSLSNSEEEPDRQQPASGKRGARKRRSSRRSAGGSAGPGGATGGGIGGGDEPGSPA
QGKRGKKSAGGGGGGGAGGGGGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIP
TLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_011658
ORF Size 618 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011658.2, NP_035788.1
RefSeq Size 1665 bp
RefSeq ORF 621 bp
Locus ID 22160
UniProt ID P26687
Cytogenetics 12 14.81 cM
Summary Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. This gene encodes a bHLH transcription factor that is evolutionarily conserved from invertebrates to humans, and was originally identified in Drosophila as an essential gene involved in early mesoderm development and dorsal-ventral patterning in the embryo. This protein plays a role in cancer by regulating the epithelial-mesenchymal transition (EMT), a process that is critical for metastasis initiation, and promoting tumor progression. Mutations in the human gene are associated with Saethre-Chotzen syndrome (SCS). Mice with heterozygous mutations in this gene exhibit cranofacial and structural defects similar to those seen in human SCS patients. [provided by RefSeq, Sep 2015]
Write Your Own Review
You're reviewing:Twist1 (NM_011658) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC209601 Twist1 (untagged) - Mouse twist homolog 1 (Drosophila) (Twist1), (10ug) 10 ug
$450.00
MR227370 Twist1 (Myc-DDK-tagged) - Mouse twist homolog 1 (Drosophila) (Twist1) 10 ug
$450.00
MR227370L1 Lenti ORF clone of Twist1 (Myc-DDK-tagged) - Mouse twist homolog 1 (Drosophila) (Twist1) 10 ug
$750.00
MR227370L2 Lenti ORF clone of Twist1 (mGFP-tagged) - Mouse twist homolog 1 (Drosophila) (Twist1) 10 ug
$750.00
MR227370L3 Lenti ORF clone of Twist1 (Myc-DDK-tagged) - Mouse twist homolog 1 (Drosophila) (Twist1) 10 ug
$750.00
MR227370L4 Lenti ORF clone of Twist1 (mGFP-tagged) - Mouse twist homolog 1 (Drosophila) (Twist1) 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.