Ascl1 (NM_008553) Mouse Tagged ORF Clone

SKU
MG227072
Ascl1 (tGFP-tagged) - Mouse achaete-scute complex homolog 1 (Drosophila) (Ascl1), (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ascl1
Synonyms AI225900; ASH1; bHLHa46; Mash1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG227072 representing NM_008553
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGCTCTGGCAAGATGGAGAGTGGAGCCGGCCAGCAGCCGCAGCCCCCGCAGCCCTTCCTGCCTC
CCGCAGCCTGCTTCTTTGCGACCGCGGCGGCGGCGGCAGCGGCGGCGGCCGCGGCAGCTCAGAGCGCGCA
GCAGCAACAGCCGCAGGCGCCGCCGCAGCAGGCGCCGCAGCTGAGCCCGGTGGCCGACAGCCAGCCCTCA
GGGGGCGGTCACAAGTCAGCGGCCAAGCAGGTCAAGCGCCAGCGCTCGTCCTCTCCGGAACTGATGCGCT
GCAAACGCCGGCTCAACTTCAGCGGCTTCGGCTACAGCCTGCCACAGCAGCAGCCGGCCGCCGTGGCGCG
CCGCAACGAGCGCGAGCGCAACCGGGTCAAGTTGGTCAACCTGGGTTTTGCCACCCTCCGGGAGCATGTC
CCCAACGGCGCGGCCAACAAGAAGATGAGCAAGGTGGAGACGCTGCGCTCGGCGGTCGAGTACATCCGCG
CGCTGCAGCAGCTGCTGGACGAGCACGACGCGGTGAGCGCTGCCTTTCAGGCGGGCGTCCTGTCGCCCAC
CATCTCCCCCAACTACTCCAACGACTTGAACTCTATGGCGGGTTCTCCGGTCTCGTCCTACTCCTCCGAC
GAGGGATCCTACGACCCTCTTAGCCCAGAGGAACAAGAGCTGCTGGACTTTACCAACTGGTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG227072 representing NM_008553
Red=Cloning site Green=Tags(s)

MESSGKMESGAGQQPQPPQPFLPPAACFFATAAAAAAAAAAAAQSAQQQQPQAPPQQAPQLSPVADSQPS
GGGHKSAAKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHV
PNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSD
EGSYDPLSPEEQELLDFTNWF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_008553
ORF Size 693 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_008553.5
RefSeq Size 2259 bp
RefSeq ORF 696 bp
Locus ID 17172
UniProt ID Q02067
Cytogenetics 10 C1
Summary Transcription factor that plays a key role in neuronal differentiation: acts as a pioneer transcription factor, accessing closed chromatin to allow other factors to bind and activate neural pathways (PubMed:24243019). Directly binds the E box motif (5'-CANNTG-3') on promoters and promotes transcription of neuronal genes (PubMed:20107439, PubMed:24243019, PubMed:27281220). The combination of three transcription factors, ASCL1, POU3F2/BRN2 and MYT1L, is sufficient to reprogram fibroblasts and other somatic cells into induced neuronal (iN) cells in vitro (PubMed:20107439, PubMed:24243019, PubMed:27281220). Plays a role at early stages of development of specific neural lineages in most regions of the CNS, and of several lineages in the PNS (PubMed:8217843). Essential for the generation of olfactory and autonomic neurons (PubMed:8221886). Acts synergistically with FOXN4 to specify the identity of V2b neurons rather than V2a from bipotential p2 progenitors during spinal cord neurogenesis, probably through DLL4-NOTCH signaling activation (PubMed:16020526, PubMed:17728344).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Ascl1 (NM_008553) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC208938 Ascl1 (untagged) - Mouse achaete-scute complex homolog 1 (Drosophila) (Ascl1), (10ug) 10 ug
$300.00
MR227072 Ascl1 (Myc-DDK-tagged) - Mouse achaete-scute complex homolog 1 (Drosophila) (Ascl1) 10 ug
$289.00 MSRP $300.00 MSRP $300.00
MR227072L1 Lenti ORF clone of Ascl1 (Myc-DDK-tagged) - Mouse achaete-scute complex homolog 1 (Drosophila) (Ascl1) 10 ug
$600.00
MR227072L2 Lenti ORF clone of Ascl1 (mGFP-tagged) - Mouse achaete-scute complex homolog 1 (Drosophila) (Ascl1) 10 ug
$600.00
MR227072L3 Lenti ORF clone of Ascl1 (Myc-DDK-tagged) - Mouse achaete-scute complex homolog 1 (Drosophila) (Ascl1) 10 ug
$600.00
MR227072L4 Lenti ORF clone of Ascl1 (mGFP-tagged) - Mouse achaete-scute complex homolog 1 (Drosophila) (Ascl1) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.