Igf1 (NM_010512) Mouse Tagged ORF Clone

SKU
MG227062
Igf1 (tGFP-tagged) - Mouse insulin-like growth factor 1 (Igf1) transcript variant 1, (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$425.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Igf1
Synonyms C730016P09Rik; Igf; Igf-; Igf-1; Igf-I
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG227062 representing NM_010512
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAAAATCAGCAGCCTTCCAACTCAATTATTTAAGATCTGCCTCTGTGACTTCTTGAAGATAAAGA
TACACATCATGTCGTCTTCACACCTCTTCTACCTGGCGCTCTGCTTGCTCACCTTCACCAGCTCCACCAC
AGCTGGACCAGAGACCCTTTGCGGGGCTGAGCTGGTGGATGCTCTTCAGTTCGTGTGTGGACCGAGGGGC
TTTTACTTCAACAAGCCCACAGGCTATGGCTCCAGCATTCGGAGGGCACCTCAGACAGGCATTGTGGATG
AGTGTTGCTTCCGGAGCTGTGATCTGAGGAGACTGGAGATGTACTGTGCCCCACTGAAGCCTACAAAAGC
AGCCCGCTCTATCCGTGCCCAGCGCCACACTGACATGCCCAAGACTCAGAAGTCCCCGTCCCTATCGACA
AACAAGAAAACGAAGCTGCAAAGGAGAAGGAAAGGAAGTACATTTGAAGAACACAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG227062 representing NM_010512
Red=Cloning site Green=Tags(s)

MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSTTAGPETLCGAELVDALQFVCGPRG
FYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAARSIRAQRHTDMPKTQKSPSLST
NKKTKLQRRRKGSTFEEHK

TRTRPLE - GFP Tag - V
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_010512
ORF Size 477 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010512.5
RefSeq Size 7121 bp
RefSeq ORF 480 bp
Locus ID 16000
UniProt ID P05017
Cytogenetics 10 43.7 cM
Summary This gene encodes a member of the insulin-like growth factor (IGF) family of proteins that promote growth and development during fetal and postnatal life. This gene is predominantly expressed in the liver and the encoded protein undergoes proteolytic processing to generate a disulfide-linked mature polypeptide. Transgenic disruption of this gene in mice results in reduced postnatal survival and severe growth retardation. Mice lacking the encoded protein exhibit generalized organ hypoplasia including underdevelopment of the central nervous system and developmental defects in bone, muscle and reproductive systems. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015]
Write Your Own Review
You're reviewing:Igf1 (NM_010512) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC208756 Igf1 (untagged) - Mouse insulin-like growth factor 1 (Igf1), transcript variant 1, (10ug) 10 ug
$225.00
MR227062 Igf1 (Myc-DDK-tagged) - Mouse insulin-like growth factor 1 (Igf1), transcript variant 1 10 ug
$225.00
MR227062L3 Lenti ORF clone of Igf1 (Myc-DDK-tagged) - Mouse insulin-like growth factor 1 (Igf1), transcript variant 1 10 ug
$525.00
MR227062L4 Lenti ORF clone of Igf1 (mGFP-tagged) - Mouse insulin-like growth factor 1 (Igf1), transcript variant 1 10 ug
$525.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.