Bglap (NM_007541) Mouse Tagged ORF Clone

SKU
MG226351
Bglap (tGFP-tagged) - Mouse bone gamma carboxyglutamate protein (Bglap) transcript variant 1, (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$425.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Bglap
Synonyms Bgl; Bglap1; BGP; mOC; mOC-A; O; OC; OG; OG1; oste
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG226351 representing NM_007541
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGACCATCTTTCTGCTCACTCTGCTGACCCTGGCTGCGCTCTGTCTCTCTGACCTCACAGATGCCA
AGCCCAGCGGCCCTGAGTCTGACAAAGCCTTCATGTCCAAGCAGGAGGGCAATAAGGTAGTGAACAGACT
CCGGCGCTACCTTGGAGCCTCAGTCCCCAGCCCAGATCCCCTGGAGCCCACCCGGGAGCAGTGTGAGCTT
AACCCTGCTTGTGACGAGCTATCAGACCAGTATGGCTTGAAGACCGCCTACAAACGCATCTATGGTATCA
CTATT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG226351 representing NM_007541
Red=Cloning site Green=Tags(s)

MRTIFLLTLLTLAALCLSDLTDAKPSGPESDKAFMSKQEGNKVVNRLRRYLGASVPSPDPLEPTREQCEL
NPACDELSDQYGLKTAYKRIYGITI

TRTRPLE - GFP Tag - V
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007541
ORF Size 285 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007541.3
RefSeq Size 494 bp
RefSeq ORF 288 bp
Locus ID 12096
UniProt ID P86546
Cytogenetics 3 38.82 cM
Summary This gene encodes one of the most abundant non-collagenous proteins in bone tissue that is localized to the mineralized matrix of bone. The encoded preproprotein undergoes proteolytic processing and post-translational gamma carboxylation to generate a mature, calcium-binding protein. Mice lacking the encoded protein develop abnormalities of bone remodelling. This gene is located adjacent to two other osteocalcin-related genes on chromosome 3. [provided by RefSeq, Oct 2015]
Write Your Own Review
You're reviewing:Bglap (NM_007541) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC208188 Bglap (untagged) - Mouse bone gamma carboxyglutamate protein (Bglap), transcript variant 1, (10ug) 10 ug
$225.00
MR226351 Bglap (Myc-DDK-tagged) - Mouse bone gamma carboxyglutamate protein (Bglap), transcript variant 1 10 ug
$225.00
MR226351L3 Lenti ORF clone of Bglap (Myc-DDK-tagged) - Mouse bone gamma carboxyglutamate protein (Bglap), transcript variant 1 10 ug
$525.00
MR226351L4 Lenti ORF clone of Bglap (mGFP-tagged) - Mouse bone gamma carboxyglutamate protein (Bglap), transcript variant 1 10 ug
$525.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.