Ceacam1 (NM_001039186) Mouse Tagged ORF Clone

SKU
MG225458
Ceacam1 (tGFP-tagged) - Mouse carcinoembryonic antigen-related cell adhesion molecule 1 (Ceacam1) transcript variant 2, (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$703.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ceacam1
Synonyms bb-1; Bgp; Bgp1; C-CAM; Cc1; CD66a; Cea-1; Cea-7; Cea1; Cea7; Hv-2; Hv2; mCEA1; Mhv-1; MHVR; MHVR1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG225458 representing NM_001039186
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGGCCTCAGCACATCTCCACAAAGGGCAGGTTCCCTGGGGAGGACTACTGCTCACAGCCTCAC
TTTTAGCCTCCTGGAGCCCTGCCACCACTGCTGAAGTCACCATTGAGGCTGTGCCGCCCCAGGTTGCTGA
AGACAACAATGTTCTTCTACTTGTTCACAATCTGCCCCTGGCGCTTGGAGCCTTTGCCTGGTACAAGGGA
AACACTACGGCTATAGACAAAGAAATTGCACGATTTGTACCAAATAGTAATATGAATTTCACGGGGCAAG
CATACAGCGGCAGAGAGATAATATACAGCAATGGATCCCTGCTCTTCCAAATGATCACCATGAAGGATAT
GGGAGTCTACACACTAGATATGACAGATGAAAACTATCGTCGTACTCAGGCGACTGTGCGATTTCATGTA
CACCCCATATTATTAAAGCCCAACATCACAAGCAACAACTCCAATCCCGTGGAGGGTGACGACTCCGTAT
CATTAACCTGTGACTCTTACACTGACCCTGATAATATAAACTACCTGTGGAGCAGAAATGGTGAAAGCCT
TTCAGAAGGTGACAGGCTGAAGCTGTCTGAGGGCAACAGGACTCTCACTTTACTCAATGTCACGAGGAAT
GACACAGGACCCTATGTGTGTGAAACCCGGAATCCAGTGAGTGTCAACCGAAGTGACCCATTCAGCCTGA
ACATTATCTATGGTCCGGACACCCCGATTATATCCCCCTCAGATATTTATTTGCATCCAGGGTCAAACCT
CAACCTCTCCTGCCATGCAGCCTCTAACCCACCTGCACAGTACTTTTGGCTTATCAATGAGAAGCCCCAT
GCATCCTCCCAAGAGCTCTTTATCCCCAACATCACTACTAATAATAGCGGAACCTATACCTGCTTCGTCA
ATAACTCTGTCACTGGCCTCAGTAGGACCACAGTCAAGAACATTACAGTCCTTGAGCCAGTGACTCAGCC
CTTCCTCCAAGTCACCAACACCACAGTCAAAGAACTAGACTCTGTGACCCTGACCTGCTTGTCGAATGAC
ATTGGAGCCAACATCCAGTGGCTCTTCAATAGCCAGAGTCTTCAGCTCACAGAGAGAATGACACTCTCCC
AGAACAACAGCATCCTCAGAATAGACCCTATTAAGAGGGAAGATGCCGGCGAGTATCAGTGTGAAATCTC
GAATCCAGTCAGCGTCAGGAGGAGCAACTCAATCAAGCTGGACATAATATTTGACCCAACACAAGGAGGC
CTCTCAGATGGCGCCATTGCTGGCATCGTGATTGGAGTTGTGGCTGGGGTGGCTCTAATAGCAGGGCTGG
CATATTTCCTCTATTCCAGGAAGTCTGGCGGATCTGGCTCCTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG225458 representing NM_001039186
Red=Cloning site Green=Tags(s)

MELASAHLHKGQVPWGGLLLTASLLASWSPATTAEVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKG
NTTAIDKEIARFVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHV
HPILLKPNITSNNSNPVEGDDSVSLTCDSYTDPDNINYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRN
DTGPYVCETRNPVSVNRSDPFSLNIIYGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLINEKPH
ASSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLEPVTQPFLQVTNTTVKELDSVTLTCLSND
IGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSVRRSNSIKLDIIFDPTQGG
LSDGAIAGIVIGVVAGVALIAGLAYFLYSRKSGGSGSF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001039186
ORF Size 1374 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001039186.1, NP_001034275.1
RefSeq Size 3683 bp
RefSeq ORF 1377 bp
Locus ID 26365
UniProt ID P31809
Cytogenetics 7 13.84 cM
Summary Isoform 1: Cell adhesion protein that mediates homophilic cell adhesion in a calcium-independent manner (By similarity). Plays a role as coinhibitory receptor in immune response, insulin action and functions also as an activator during angiogenesis (PubMed:16680193, PubMed:17081782, PubMed:18544705, PubMed:21029969, PubMed:21081647, PubMed:22496641, PubMed:22962327, PubMed:23696226). Its coinhibitory receptor function is phosphorylation- and PTPN6 -dependent, which in turn, suppress signal transduction of associated receptors by dephosphorylation of their downstream effectors (PubMed:17081782, PubMed:21029969, PubMed:22496641). Plays a role in immune response, of T-cells, natural killer (NK) and neutrophils (PubMed:17081782, PubMed:23696226, PubMed:22496641, PubMed:21029969). Upon TCR/CD3 complex stimulation, inhibits TCR-mediated cytotoxicity by blocking granule exocytosis by mediating homophilic binding to adjacent cells, allowing interaction with and phosphorylation by LCK and interaction with the TCR/CD3 complex which recruits PTPN6 resulting in dephosphorylation of CD247 and ZAP70 (PubMed:22496641). Also inhibits T-cell proliferation and cytokine production through inhibition of JNK cascade and plays a crucial role in regulating autoimmunity and anti-tumor immunity by inhibiting T-cell through its interaction with HAVCR2 (PubMed:17081782). Upon natural killer (NK) cells activation, inhibit KLRK1-mediated cytolysis of CEACAM1-bearing tumor cells by trans-homophilic interactions with CEACAM1 on the target cell and lead to cis-interaction between CEACAM1 and KLRK1, allowing PTPN6 recruitment and then VAV1 dephosphorylation (PubMed:23696226). Upon neutrophils activation negatively regulates IL1B production by recruiting PTPN6 to a SYK-TLR4-CEACAM1 complex, that dephosphorylates SYK, reducing the production of reactive oxygen species (ROS) and lysosome disruption, which in turn, reduces the activity of the inflammasome (PubMed:22496641). Downregulates neutrophil production by acting as a coinhibitory receptor for CSF3R by downregulating the CSF3R-STAT3 pathway through recruitment of PTPN6 that dephosphorylates CSF3R (PubMed:21029969). Also regulates insulin action by promoting INS clearance and regulating lipogenesis in liver through regulating insulin signaling (PubMed:18544705). Upon INS stimulation, undergoes phosphorylation by INSR leading to INS clearance by increasing receptor-mediated insulin endocytosis. This inernalization promotes interaction with FASN leading to receptor-mediated insulin degradation and to reduction of FASN activity leading to negative regulation of fatty acid synthesis. INSR-mediated phosphorylation also provokes a down-regulation of cell proliferation through SHC1 interaction resulting in decrease coupling of SHC1 to the MAPK3/ERK1-MAPK1/ERK2 and phosphatidylinositol 3-kinase pathways (By similarity). Functions as activator in angiogenesis by promoting blood vessel remodeling through endothelial cell differentiation and migration and in arteriogenesis by increasing the number of collateral arteries and collateral vessel calibers after ischemia (PubMed:16680193, PubMed:22962327). Also regulates vascular permeability through the VEGFR2 signaling pathway resulting in control of nitric oxide production (PubMed:21081647). Downregulates cell growth in response to EGF through its interaction with SHC1 that mediates interaction with EGFR resulting in decrease coupling of SHC1 to the MAPK3/ERK1-MAPK1/ERK2 pathway (PubMed:15467833). Negatively regulates platelet aggregation by decreasing platelet adhesion on type I collagen through the GPVI-FcRgamma complex (PubMed:19008452). Inhibits cell migration and cell scattering through interaction with FLNA; interfers with the interaction of FLNA with RALA (By similarity). Mediates bile acid transport activity in a phosphorylation dependent manner (By similarity). Negatively regulates osteoclastogenesis (PubMed:25490771).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Ceacam1 (NM_001039186) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC216138 Ceacam1 (untagged) - Mouse carcinoembryonic antigen-related cell adhesion molecule 1 (Ceacam1), transcript variant 2, (10ug) 10 ug
$503.00
MR225458 Ceacam1 (Myc-DDK-tagged) - Mouse carcinoembryonic antigen-related cell adhesion molecule 1 (Ceacam1), transcript variant 2 10 ug
$503.00
MR225458L3 Lenti ORF clone of Ceacam1 (Myc-DDK-tagged) - Mouse carcinoembryonic antigen-related cell adhesion molecule 1 (Ceacam1), transcript variant 2 10 ug
$803.00
MR225458L4 Lenti ORF clone of Ceacam1 (mGFP-tagged) - Mouse carcinoembryonic antigen-related cell adhesion molecule 1 (Ceacam1), transcript variant 2 10 ug
$803.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.