Ccl20 (NM_016960) Mouse Tagged ORF Clone
SKU
MG224546
Ccl20 (tGFP-tagged) - Mouse chemokine (C-C motif) ligand 20 (Ccl20) transcript variant 1, (10ug)
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Mouse Tagged ORF Clone |
---|---|
Target Symbol | Ccl20 |
Synonyms | CKb4; exodus-1; LARC; MIP-3A; MIP-3[a]; MIP3A; Scya20; ST38 |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>MG224546 representing NM_016960
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCTGCGGTGGCAAGCGTCTGCTCTTCCTTGCTTTGGCATGGGTACTGCTGGCTCACCTCTGCAGCC AGGCAGAAGCAGCAAGCAACTACGACTGTTGCCTCTCGTACATACAGACGCCTCTTCCTTCCAGAGCTAT TGTGGGTTTCACAAGACAGATGGCCGATGAAGCTTGTGACATTAATGCTATCATCTTTCACACGAAGAAA AGAAAATCTGTGTGCGCTGATCCAAAGCAGAACTGGGTGAAAAGGGCTGTGAACCTCCTCAGCCTAAGAG TCAAGAAGATG ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG224546 representing NM_016960
Red=Cloning site Green=Tags(s) MACGGKRLLFLALAWVLLAHLCSQAEAASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKK RKSVCADPKQNWVKRAVNLLSLRVKKM TRTRPLE - GFP Tag - V |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_016960 |
ORF Size | 291 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_016960.2, NP_058656.1 |
RefSeq Size | 852 bp |
RefSeq ORF | 294 bp |
Locus ID | 20297 |
UniProt ID | O89093 |
Cytogenetics | 1 42.69 cM |
Summary | Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed:9862452, PubMed:20068036). The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and autoimmune diseases (PubMed:21376174). CCL20 acts as a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes (By similarity). Involved in the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation (PubMed:19050256). Required for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells (PubMed:24638065). Positively regulates sperm motility and chemotaxis via its binding to CCR6 which triggers Ca2+ mobilization in the sperm which is important for its motility (PubMed:25122636). May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells (PubMed:10064080).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
MC201363 | Ccl20 (untagged) - Mouse chemokine (C-C motif) ligand 20 (Ccl20), transcript variant 1, (10ug) | 10 ug |
$225.00
|
|
MG200285 | Ccl20 (tGFP-tagged) - Mouse chemokine (C-C motif) ligand 20 (Ccl20) | 10 ug |
$425.00
|
|
MR224546 | Ccl20 (Myc-DDK-tagged) - Mouse chemokine (C-C motif) ligand 20 (Ccl20), transcript variant 1 | 10 ug |
$225.00
|
|
MR224546L3 | Lenti ORF clone of Ccl20 (Myc-DDK-tagged) - Mouse chemokine (C-C motif) ligand 20 (Ccl20), transcript variant 1 | 10 ug |
$525.00
|
|
MR224546L4 | Lenti ORF clone of Ccl20 (mGFP-tagged) - Mouse chemokine (C-C motif) ligand 20 (Ccl20), transcript variant 1 | 10 ug |
$525.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.