Iqgap2 (NM_027711) Mouse Tagged ORF Clone

SKU
MG223272
Iqgap2 (tGFP-tagged) - Mouse IQ motif containing GTPase activating protein 2 (Iqgap2), (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$1,547.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Iqgap2
Synonyms 4933417J23Rik; A630053O10; AI788777
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG223272 representing NM_027711
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGCACGAAGAGCTGCCGTCGTTGCAACGGCCCCGCTACGGCTCAATCGTGGATGATGAAAGGCTGT
CTGCAGAGGAGATGGATGAGAGGAGGCGACAGAACATCGCCTATGAATACTTGTGTCACCTGGAGGAAGC
CAAGAGATGGATGGAAGTCTGCTTAGTTGAAGAATTGCCACCAACCACTGAACTGGAAGAAGGGCTCCGG
AATGGGGTCTACCTCGCCAAGTTAGCCAAGTTCTTCGCTCCGAAAATGGTATCAGAGAAGAAGATCTATG
ATGTGGAGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG223272 representing NM_027711
Red=Cloning site Green=Tags(s)

MPHEELPSLQRPRYGSIVDDERLSAEEMDERRRQNIAYEYLCHLEEAKRWMEVCLVEELPPTTELEEGLR
NGVYLAKLAKFFAPKMVSEKKIYDVEQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_027711
ORF Size 291 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_027711.1, NP_081987.1
RefSeq Size 5771 bp
RefSeq ORF 4728 bp
Locus ID 544963
UniProt ID Q3UQ44
Cytogenetics 13 50.26 cM
Summary Binds to activated CDC42 and RAC1 but does not seem to stimulate their GTPase activity. Associates with calmodulin.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Iqgap2 (NM_027711) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC224705 Iqgap2 (untagged) - Mouse IQ motif containing GTPase activating protein 2 (Iqgap2), (10ug) 10 ug
$1,483.00
MR223272 Iqgap2 (Myc-DDK-tagged) - Mouse IQ motif containing GTPase activating protein 2 (Iqgap2) 10 ug
$589.00 MSRP $1,347.00 MSRP $1,347.00
MR223272L3 Lenti ORF clone of Iqgap2 (Myc-DDK-tagged) - Mouse IQ motif containing GTPase activating protein 2 (Iqgap2) 10 ug
$1,647.00
MR223272L4 Lenti ORF clone of Iqgap2 (mGFP-tagged) - Mouse IQ motif containing GTPase activating protein 2 (Iqgap2) 10 ug
$1,647.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.