Chmp6 (NM_001085498) Mouse Tagged ORF Clone

SKU
MG217134
Chmp6 (tGFP-tagged) - Mouse chromatin modifying protein 6 (Chmp6), (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Chmp6
Synonyms 2400004G01Rik
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG217134 representing NM_001085498
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAACCTGTTCGGCCGCAAGAAGCAGAGCCGAGTCACCGAACAGGACAGGGCCATCCTGCAACTGA
AGCAGCAGAGGGACAAACTGAGGCAGTACCAGAAGAGGGTCACGCAGCAGCTGGAGAGGGAGCGGGCCCT
GGCCAGGCAGCTGCTGCGGGATGGCAGGAAAGAACGAGCCAAGCTGCTGCTCAAGAAGAAGAGGTACCGG
GAGCAACTGCTCGATAGGACAGAAAACCAGATCAGCAGCCTGGAAGCCATGGTTCAGAGCATCGAGTTCA
CGCAGATCGAGATGAAGGTGATGGAGGGGCTACAGGTGGGGAACGAATGTCTGAATAAGATGCACCAGGT
GATGTCCATAGAGGAGGTGGAGAGGATCCTGGACGAGACCCAGGAGGCAGTGGAGTACCAGCGGCAAATT
GATGAGCTGCTGGCCGGAAACTTCACCCAGGAGGATGAGGACGCCATCCTGGAAGAGCTGAATGCAATCA
CTCAGGAACAAATGGAGTTACCAGAGGTTCCGTCAGAGCCGCTCCCTGACCGAAACCCAGAAGCCCCTGC
CAAGGCCAGATCCAGGCAGGCAGAGCTGGTGGCGGCTTCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG217134 representing NM_001085498
Red=Cloning site Green=Tags(s)

MGNLFGRKKQSRVTEQDRAILQLKQQRDKLRQYQKRVTQQLERERALARQLLRDGRKERAKLLLKKKRYR
EQLLDRTENQISSLEAMVQSIEFTQIEMKVMEGLQVGNECLNKMHQVMSIEEVERILDETQEAVEYQRQI
DELLAGNFTQEDEDAILEELNAITQEQMELPEVPSEPLPDRNPEAPAKARSRQAELVAAS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001085498
ORF Size 600 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001085498.2, NP_001078967.1
RefSeq Size 1561 bp
RefSeq ORF 603 bp
Locus ID 208092
UniProt ID P0C0A3
Cytogenetics 11 E2
Summary Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. In the ESCRT-III complex, it probably serves as an acceptor for the ESCRT-II complex on endosomal membranes (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Chmp6 (NM_001085498) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC212494 Chmp6 (untagged) - Mouse chromatin modifying protein 6 (Chmp6), (10ug) 10 ug
$330.00
MR217134 Chmp6 (Myc-DDK-tagged) - Mouse chromatin modifying protein 6 (Chmp6) 10 ug
$289.00 MSRP $300.00 MSRP $300.00
MR217134L3 Lenti ORF clone of Chmp6 (Myc-DDK-tagged) - Mouse chromatin modifying protein 6 (Chmp6) 10 ug
$600.00
MR217134L4 Lenti ORF clone of Chmp6 (mGFP-tagged) - Mouse chromatin modifying protein 6 (Chmp6) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.