Pld6 (NM_183139) Mouse Tagged ORF Clone

SKU
MG216594
Pld6 (tGFP-tagged) - Mouse phospholipase D family member 6 (Pld6), (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Pld6
Synonyms 4933433K01Rik; Gm10; mitoPLD; mZuc; Zuc
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG216594 representing NM_183139
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCGCTCGAGTTGGCGGTTGGTGTTCGCGGCTGGTGCGGGTCTCGCGCTGGCCCTAGAGGCACTGC
CGTGGCTGATGCGTTGGCTGCTGGCTGGGCGGCGGCCAAGGCGCGAGGTGCTCTTCTTCCCCTCACAGGT
GACCTGCACCGAGGCTTTACTGCAGGCCCCAGGGTTGCCTCCCGGGCCCTCGGGCTGCCCGTGTAGCCTC
CCCCACAGCGAGAGTTCACTGAGCCGCCTGCTGCGCGCGCTGTTGGCCGCCCGCTCCAGCTTGGAGCTCT
GCCTCTTCGCCTTCTCCAGCCCGCAGCTGGGGCGTGCAGTGCAGCTGCTGCATCAGCGTGGGGTGCGCGT
GCGGGTCATCACTGACTGCGACTACATGGCCCTCAACGGCTCTCAGATCGGCCTGCTGCGCAAGGGATAC
AGGTACGGCACGACCAGGACC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG216594 representing NM_183139
Red=Cloning site Green=Tags(s)

MGRSSWRLVFAAGAGLALALEALPWLMRWLLAGRRPRREVLFFPSQVTCTEALLQAPGLPPGPSGCPCSL
PHSESSLSRLLRALLAARSSLELCLFAFSSPQLGRAVQLLHQRGVRVRVITDCDYMALNGSQIGLLRKGY
RYGTTRT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_183139
ORF Size 441 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_183139.2, NP_898962.2
RefSeq Size 1769 bp
RefSeq ORF 444 bp
Locus ID 194908
UniProt ID Q5SWZ9
Cytogenetics 11 B1.3
Summary Endonuclease that plays a critical role in PIWI-interacting RNA (piRNA) biogenesis during spermatogenesis. piRNAs provide essential protection against the activity of mobile genetic elements. piRNA-mediated transposon silencing is thus critical for maintaining genome stability, in particular in germline cells when transposons are mobilized as a consequence of wide-spread genomic demethylation (PubMed:23064227, PubMed:23064230). Has been proposed to act as a cardiolipin hydrolase to generate phosphatidic acid at mitochondrial surface (PubMed:21397847, PubMed:21397848). Although it cannot be excluded that it can act as a phospholipase in some circumstances, it should be noted that cardiolipin hydrolase activity is either undetectable in vitro, or very low. In addition, cardiolipin is almost exclusively found on the inner mitochondrial membrane, while PLD6 localizes to the outer mitochondrial membrane, facing the cytosol. Has been shown to be a backbone-non-specific, single strand-specific nuclease, cleaving either RNA or DNA substrates with similar affinity (PubMed:23064227, PubMed:23064230). Produces 5' phosphate and 3' hydroxyl termini, suggesting it could directly participate in the processing of primary piRNA transcripts (PubMed:23064230). Also acts as a regulator of mitochondrial shape through facilitating mitochondrial fusion (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Pld6 (NM_183139) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC212466 Pld6 (untagged) - Mouse phospholipase D family, member 6 (Pld6), (10ug) 10 ug
$165.00
MR216594 Pld6 (Myc-DDK-tagged) - Mouse phospholipase D family, member 6 (Pld6) 10 ug
$289.00
MR216594L3 Lenti ORF clone of Pld6 (Myc-DDK-tagged) - Mouse phospholipase D family, member 6 (Pld6) 10 ug
$450.00
MR216594L4 Lenti ORF clone of Pld6 (mGFP-tagged) - Mouse phospholipase D family, member 6 (Pld6) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.