Fam229b (NM_183254) Mouse Tagged ORF Clone

SKU
MG212932
Fam229b (tGFP-tagged) - Mouse RIKEN cDNA 1700025K23 gene (1700025K23Rik), (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fam229b
Synonyms 1700025K23Rik
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG212932 representing NM_183254
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTTTTCGGTTTGGGACCCAGCCAAGGAGGTTTCCAGTGGAAGGAGGAGACTCTTCAATTGAGCTAG
AATCAGGCCTGAGCTCTAGTGCTTCCTGTACCGGGAAAGAGACGTCACCCAATAGGCAACTCCGAAGATG
CCCTGGAAGTCACTGCCTGACAATAACTGATGTTCCCATCACTGTCTATGCAACAATGAGAAAGCCACCT
GCGCAAAGCAGCAAGGAAATGCATCCCAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG212932 representing NM_183254
Red=Cloning site Green=Tags(s)

MPFRFGTQPRRFPVEGGDSSIELESGLSSSASCTGKETSPNRQLRRCPGSHCLTITDVPITVYATMRKPP
AQSSKEMHPK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_183254
ORF Size 240 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_183254.2
RefSeq Size 731 bp
RefSeq ORF 243 bp
Locus ID 66337
UniProt ID Q8CF36
Cytogenetics 10 B1
Write Your Own Review
You're reviewing:Fam229b (NM_183254) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC210335 Fam229b (untagged) - Mouse RIKEN cDNA 1700025K23 gene (1700025K23Rik), (10ug) 10 ug
$165.00
MR212932 Fam229b (Myc-DDK-tagged) - Mouse RIKEN cDNA 1700025K23 gene (1700025K23Rik) 10 ug
$289.00
MR212932L3 Lenti ORF clone of Fam229b (Myc-DDK-tagged) - Mouse RIKEN cDNA 1700025K23 gene (1700025K23Rik) 10 ug
$450.00
MR212932L4 Lenti ORF clone of Fam229b (mGFP-tagged) - Mouse RIKEN cDNA 1700025K23 gene (1700025K23Rik) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.