Vegfc (NM_009506) Mouse Tagged ORF Clone

SKU
MG206551
Vegfc (tGFP-tagged) - Mouse vascular endothelial growth factor C (Vegfc)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $657.00 MSRP $657.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Vegfc
Synonyms AW228853; VEGF-C
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
Protein Sequence
>MG206551 representing NM_009506
Red=Cloning site Green=Tags(s)

MHLLCFLSLACSLLAAALIPSPREAPATVAAFESGLGFSEAEPDGGEVKAFEGKDLEEQLRSVSSVDELM
SVLYPDYWKMYKCQLRKGGWQQPTLNTRTGDSVKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEF
GAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSK
LDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYVWNNYMCRCLAQQDFIFYSNVEDDSTNGFHDVCGPNK
ELDEDTCQCVCKGGLRPSSCGPHKELDRDSCQCVCKNKLFPNSCGANREFDENTCQCVCKRTCPRNQPLN
PGKCACECTENTQKCFLKGKKFHHQTCSCYRRPCANRLKHCDPGLSFSEEVCRCVPSYWKRPHLN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_009506
ORF Size 1245 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009506.2, NP_033532.1
RefSeq Size 1881 bp
RefSeq ORF 1248 bp
Locus ID 22341
UniProt ID P97953
Cytogenetics 8 B1.3
Summary Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Vegfc (NM_009506) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207442 Vegfc (untagged) - Mouse vascular endothelial growth factor C (Vegfc), (10ug) 10 ug
$457.00
MR206551 Vegfc (Myc-DDK-tagged) - Mouse vascular endothelial growth factor C (Vegfc) 10 ug
$289.00 MSRP $457.00 MSRP $457.00
MR206551L3 Lenti ORF clone of Vegfc (Myc-DDK-tagged) - Mouse vascular endothelial growth factor C (Vegfc) 10 ug
$757.00
MR206551L4 Lenti ORF clone of Vegfc (mGFP-tagged) - Mouse vascular endothelial growth factor C (Vegfc) 10 ug
$757.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.