Arc (NM_018790) Mouse Tagged ORF Clone

SKU
MG206218
Arc (tGFP-tagged) - Mouse activity regulated cytoskeletal-associated protein (Arc)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$886.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Arc
Synonyms Arc3.1; arg3.1; C86064; mArc
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG206218 representing NM_018790
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGGACCATATGACCACCGGCGGCCTCCACGCCTACCCTGCCCCGCGGGGTGGGCCGGCCGCCA
AACCCAATGTGATCCTGCAGATTGGTAAGTGCCGAGCTGAGATGCTGGAACACGTACGGAGGACCCACCG
GCATCTGTTGACCGAAGTGTCCAAGCAGGTGGAGCGAGAGCTGAAAGGGTTGCACAGGTCGGTGGGCAAG
CTGGAGAACAACTTGGACGGCTACGTGCCCACCGGCGACTCACAGCGCTGGAAGAAGTCCATCAAGGCCT
GTCTTTGCCGCTGCCAGGAGACCATCGCCAACCTGGAGCGCTGGGTCAAGCGTGAGATGCACGTGTGGAG
GGAGGTCTTCTACCGTCTGGAGAGGTGGGCTGACCGCCTGGAGTCCATGGGCGGCAAATACCCAGTGGGC
AGCGAGCCGGCCCGCCACACTGTCTCTGTAGGTGTGGGGGGTCCAGAGCCCTACTGCCAGGAAGCTGATG
GCTATGACTATACCGTTAGCCCCTATGCCATCACCCCGCCACCTGCCGCAGGAGAACTGCCTGAACAGGA
GTCAGTTGAGGCTCAGCAATATCAGTCTTGGGGGCCAGGTGAGGATGGGCAACCGAGCCCTGGTGTGGAT
ACACAGATCTTCGAGGACCCACGGGAGTTCCTGAGCCACCTGGAAGAGTACCTGCGGCAGGTGGGTGGCT
CTGAAGAATATTGGCTGTCCCAGATCCAGAACCACATGAATGGGCCAGCCAAGAAGTGGTGGGAGTTCAA
GCAGGGCTCGGTGAAGAACTGGGTGGAGTTCAAGAAGGAGTTTCTGCAATACAGTGAGGGTACACTCTCC
CGTGAAGCCATTCAGCGGGAGCTGGAGCTGCCGCAGAAGCAGGGTGAACCACTCGACCAGTTCCTCTGGC
GCAAGCGGGACCTGTACCAGACACTGTATGTGGACGCTGAGGAGGAGGAGATCATTCAGTATGTGGTGGG
CACCCTGCAGCCCAAACTCAAGCGCTTTCTGCGCCACCCACTCCCCAAGACCCTGGAGCAGCTTATCCAG
AGGGGTATGGAAGTGCAGGACGGCCTGGAGCAGGCAGCTGAGCCTTCTGGCACCCCACTGCCCACAGAGG
ATGAGACGGAGGCACTCACACCTGCTCTTACCAGCGAGTCAGTAGCCAGTGACAGGACCCAGCCTGAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG206218 representing NM_018790
Red=Cloning site Green=Tags(s)

MELDHMTTGGLHAYPAPRGGPAAKPNVILQIGKCRAEMLEHVRRTHRHLLTEVSKQVERELKGLHRSVGK
LENNLDGYVPTGDSQRWKKSIKACLCRCQETIANLERWVKREMHVWREVFYRLERWADRLESMGGKYPVG
SEPARHTVSVGVGGPEPYCQEADGYDYTVSPYAITPPPAAGELPEQESVEAQQYQSWGPGEDGQPSPGVD
TQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLS
REAIQRELELPQKQGEPLDQFLWRKRDLYQTLYVDAEEEEIIQYVVGTLQPKLKRFLRHPLPKTLEQLIQ
RGMEVQDGLEQAAEPSGTPLPTEDETEALTPALTSESVASDRTQPE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018790
ORF Size 1188 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018790.3
RefSeq Size 3059 bp
RefSeq ORF 1191 bp
Locus ID 11838
UniProt ID Q9WV31
Cytogenetics 15 34.25 cM
Summary Master regulator of synaptic plasticity that self-assembles into virion-like capsids that encapsulate RNAs and mediate intercellular RNA transfer in the nervous system (By similarity). ARC protein is released from neurons in extracellular vesicles that mediate the transfer of ARC mRNA into new target cells, where ARC mRNA can undergo activity-dependent translation (By similarity). ARC capsids are endocytosed and are able to transfer ARC mRNA into the cytoplasm of neurons (By similarity). Acts as a key regulator of synaptic plasticity: required for protein synthesis-dependent forms of long-term potentiation (LTP) and depression (LTD) and for the formation of long-term memory (PubMed:29264923, PubMed:24094104). Regulates synaptic plasticity by promoting endocytosis of AMPA receptors (AMPARs) in response to synaptic activity: this endocytic pathway maintains levels of surface AMPARs in response to chronic changes in neuronal activity through synaptic scaling, thereby contributing to neuronal homeostasis (PubMed:17088213, PubMed:20211139, PubMed:20228806). Acts as a postsynaptic mediator of activity-dependent synapse elimination in the developing cerebellum by mediating elimination of surplus climbing fiber synapses (PubMed:23791196). Accumulates at weaker synapses, probably to prevent their undesired enhancement (By similarity). This suggests that ARC-containing virion-like capsids may be required to eliminate synaptic material (By similarity). Required to transduce experience into long-lasting changes in visual cortex plasticity and for long-term memory (PubMed:17088210, PubMed:20228806). Involved in postsynaptic trafficking and processing of amyloid-beta A4 (APP) via interaction with PSEN1 (PubMed:22036569). In addition to its role in synapses, also involved in the regulation of the immune system: specifically expressed in skin-migratory dendritic cells and regulates fast dendritic cell migration, thereby regulating T-cell activation (PubMed:28783680).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Arc (NM_018790) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC208145 Arc (untagged) - Mouse activity regulated cytoskeletal-associated protein (Arc), (10ug) 10 ug
$686.00
MR206218 Arc (Myc-DDK-tagged) - Mouse activity regulated cytoskeletal-associated protein (Arc) 10 ug
$686.00
MR206218L1 Lenti ORF clone of Arc (Myc-DDK-tagged) - Mouse activity regulated cytoskeletal-associated protein (Arc) 10 ug
$986.00
MR206218L2 Lenti ORF clone of Arc (mGFP-tagged) - Mouse activity regulated cytoskeletal-associated protein (Arc) 10 ug
$986.00
MR206218L3 Lenti ORF clone of Arc (Myc-DDK-tagged) - Mouse activity regulated cytoskeletal-associated protein (Arc) 10 ug
$986.00
MR206218L4 Lenti ORF clone of Arc (mGFP-tagged) - Mouse activity regulated cytoskeletal-associated protein (Arc) 10 ug
$986.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.