Sirt6 (NM_181586) Mouse Tagged ORF Clone

SKU
MG204964
Sirt6 (tGFP-tagged) - Mouse sirtuin 6 (silent mating type information regulation 2, homolog) 6 (S. cerevisiae) (Sirt6)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$886.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Sirt6
Synonyms 2810449N18Rik; AI043036; Sir2l6
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG204964 representing NM_181586
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGTGAATTATGCAGCAGGGTTGTCGCCTTACGCGGATAAGGGCAAGTGCGGGCTGCCCGAGATCT
TCGACCCACCAGAGGAGCTGGAACGCAAGGTGTGGGAGCTGGCCCGGCTAATGTGGCAGTCCTCCAGCGT
GGTTTTCCACACGGGCGCCGGCATCAGCACCGCCTCTGGCATCCCCGACTTCAGAGGCCCCCATGGCGTG
TGGACCATGGAGGAACGCGGCCTGGCCCCCAAGTTTGACACCACCTTCGAGAATGCTCGGCCCTCGAAGA
CCCACATGGCCCTGGTTCAGCTAGAACGCATGGGCTTCCTCAGCTTCCTGGTCAGCCAGAACGTAGACGG
GCTGCACGTGCGCTCGGGCTTCCCCAGGGACAAGCTGGCAGAGCTGCACGGAAACATGTTTGTAGAGGAA
TGTCCCAAGTGTAAGACGCAGTACGTCAGAGACACGGTTGTGGGCACCATGGGCCTCAAGGCCACAGGCC
GGCTCTGCACCGTGGCCAAGACCAGGGGACTTCGGGCCTGTAGAGGGGAGCTGAGAGACACCATTCTGGA
CTGGGAGGACTCGTTGCCTGACCGGGACCTGATGCTCGCTGATGAGGCCAGCAGGACCGCAGACCTGTCT
GTCACCCTGGGTACCTCGCTGCAGATCCGCCCCAGTGGGAACCTGCCCCTTGCCACTAAGCGCCGAGGAG
GCCGTCTGGTCATTGTCAACCTGCAACCCACAAAACATGACCGCCAGGCTGACCTGCGCATCCACGGCTA
CGTGGATGAGGTGATGTGCAGACTCATGAAGCATCTGGGGCTGGAGATTCCAGCCTGGGATGGACCCTGC
GTGCTAGACAAAGCCCTGCCACCTCTGCCTCGCCCAGTAGCACTCAAGGCTGAGCCCCCCGTGCATCTCA
ATGGTGCAGTGCATGTTTCGTATAAGTCCAAGCCCAACAGCCCTATACTCCACAGGCCCCCCAAAAGAGT
GAAGACCGAGGCTGCCCCCAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG204964 representing NM_181586
Red=Cloning site Green=Tags(s)

MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLMWQSSSVVFHTGAGISTASGIPDFRGPHGV
WTMEERGLAPKFDTTFENARPSKTHMALVQLERMGFLSFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEE
CPKCKTQYVRDTVVGTMGLKATGRLCTVAKTRGLRACRGELRDTILDWEDSLPDRDLMLADEASRTADLS
VTLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPC
VLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_181586
ORF Size 1002 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181586.4
RefSeq Size 1703 bp
RefSeq ORF 1005 bp
Locus ID 50721
UniProt ID P59941
Cytogenetics 10 39.72 cM
Summary NAD-dependent protein deacetylase. Has deacetylase activity towards histone H3K9Ac and H3K56Ac. Modulates acetylation of histone H3 in telomeric chromatin during the S-phase of the cell cycle. Deacetylates histone H3K9Ac at NF-kappa-B target promoters and may down-regulate the expression of a subset of NF-kappa-B target genes. Deacetylation of nucleosomes interferes with RELA binding to target DNA. May be required for the association of WRN with telomeres during S-phase and for normal telomere maintenance. On DNA damage, promotes DNA end resection via deacetylation of RBBP8. Has very weak deacetylase activity and can bind NAD(+) in the absence of acetylated substrate (By similarity). Acts as a corepressor of the transcription factor Hif1a to control the expression of multiple glycolytic genes to regulate glucose homeostasis. Required for genomic stability. Required for normal IGF1 serum levels and normal glucose homeostasis. Modulates cellular senescence and apoptosis. Regulates the production of TNF protein. Has a role in the regulation of life span in male mice, but not in female mice.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Sirt6 (NM_181586) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207484 Sirt6 (untagged) - Mouse sirtuin 6 (silent mating type information regulation 2, homolog) 6 (S. cerevisiae) (Sirt6), transcript variant 1, (10ug) 10 ug
$686.00
MR204964 Sirt6 (Myc-DDK-tagged) - Mouse sirtuin 6 (silent mating type information regulation 2, homolog) 6 (S. cerevisiae) (Sirt6), transcript variant 1 10 ug
$686.00
MR204964L3 Lenti ORF clone of Sirt6 (Myc-DDK-tagged) - Mouse sirtuin 6 (silent mating type information regulation 2, homolog) 6 (S. cerevisiae) (Sirt6), transcript variant 1 10 ug
$986.00
MR204964L4 Lenti ORF clone of Sirt6 (mGFP-tagged) - Mouse sirtuin 6 (silent mating type information regulation 2, homolog) 6 (S. cerevisiae) (Sirt6), transcript variant 1 10 ug
$986.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.