Srsf1 (NM_173374) Mouse Tagged ORF Clone

SKU
MG203152
Srsf1 (tGFP-tagged) - Mouse splicing factor, arginine/serine-rich 1 (ASF/SF2) (Sfrs1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Srsf1
Synonyms 1110054N12Rik; 5730507C05Rik; 6330415C05Rik; AI482334; Asf; AW491331; Sf; Sf2; Sfrs1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG203152 representing NM_173374
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGGAGGTGGTGTGATCCGTGGCCCGGCGGGGAACAACGACTGCCGCATCTACGTGGGTAACCTAC
CTCCGGATATCCGAACCAAGGACATCGAGGACGTGTTTTACAAATACGGCGCCATCCGCGACATCGACCT
GAAGAACCGCCGCGGGGGACCGCCCTTCGCCTTCGTTGAGTTCGAGGACCCGCGAGACGCGGAAGATGCG
GTGTACGGTCGCGACGGCTACGACTACGACGGCTACCGGCTGCGGGTAGAGTTTCCCCGAAGCGGCCGCG
GGACCGGCCGAGGCGGCGGCGGGGGTGGAGGCGGCGGCGCCCCGAGAGGCCGCTATGGCCCGCCGTCCAG
GCGGTCCGAGAACAGAGTGGTTGTCTCTGGACTGCCTCCGAGTGGAAGCTGGCAGGACTTAAAGGATCAC
ATGCGTGAGGCAGGTGATGTATGTTACGCTGATGTTTACCGAGATGGCACTGGTGTCGTGGAGTTTGTAC
GGAAAGAAGATATGACGTATGCAGTTCGAAAACTGGATAACACTAAGTTTAGATCTCACGAGGGAGAAAC
TGCCTACATCCGGGTTAAAGTTGATGGGCCCAGAAGTCCAAGTTATGGAAGATCTCGATCTCGAAGCCGT
AGTCGTAGCAGAAGCCGTAGCAGAAGCAACAGCAGGAGTCGCAGTTACTCCCCAAGGAGAAGCAGAGGAT
CACCACGCTATTCTCCCCGTCATAGCAGATCTCGCTCTCGTACA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG203152 representing NM_173374
Red=Cloning site Green=Tags(s)

MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDA
VYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDH
MREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR
SRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_173374
ORF Size 744 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_173374.4, NP_775550.2
RefSeq Size 5066 bp
RefSeq ORF 747 bp
Locus ID 110809
UniProt ID Q6PDM2
Cytogenetics 11 52.4 cM
Summary The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010]
Write Your Own Review
You're reviewing:Srsf1 (NM_173374) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207837 Srsf1 (untagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 1, (10ug) 10 ug
$480.00
MR203152 Srsf1 (Myc-DDK-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 1 10 ug
$450.00
MR203152L1 Lenti ORF clone of Srsf1 (Myc-DDK-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 1 10 ug
$750.00
MR203152L2 Lenti ORF clone of Srsf1 (mGFP-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 1 10 ug
$750.00
MR203152L3 Lenti ORF clone of Srsf1 (Myc-DDK-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 1 10 ug
$750.00
MR203152L4 Lenti ORF clone of Srsf1 (mGFP-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 1 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.