Nudt21 (NM_026623) Mouse Tagged ORF Clone

SKU
MG202679
Nudt21 (tGFP-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 21 (Nudt21)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nudt21
Synonyms 25kDa; 3110048P04Rik; 5730530J16Rik; AU014860; AW549947; Cpsf5
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202679 representing NM_026623
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGTGGTGCCGCCCAATCGCTCGCAGACGGGCTGGCCCCGGGGGGTCAACCAGTTCGGCAACAAGT
ACATCCAGCAGACCAAGCCCCTCACCCTGGAGCGCACCATTAATCTGTACCCGCTTACCAATTATACTTT
TGGTACAAAGGAGCCCCTCTATGAGAAGGACAGCTCTGTTGCAGCCAGATTTCAGCGCATGAGGGAGGAA
TTTGATAAGATTGGGATGAGAAGGACTGTAGAAGGGGTTCTGATTGTTCATGAACACCGCCTGCCCCACG
TGCTCCTGCTGCAGCTGGGGACAACTTTCTTCAAATTACCTGGTGGGGAACTTAACCCAGGAGAAGATGA
AGTTGAAGGACTAAAACGCTTAATGACAGAGATACTTGGTCGTCAAGATGGAGTCCTGCAAGACTGGGTC
ATTGATGACTGCATTGGGAACTGGTGGAGACCAAATTTTGAACCTCCTCAGTATCCGTATATTCCTGCAC
ATATAACAAAACCCAAGGAACATAAGAAGTTGTTTCTGGTTCAGCTTCAAGAGAAAGCCTTGTTTGCAGT
CCCTAAAAATTACAAGCTGGTAGCTGCACCATTGTTTGAGCTGTATGACAATGCACCGGGGTATGGACCC
ATCATTTCTAGTCTTCCTCAGCTGCTGAGCAGGTTCAATTTTATATACAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202679 representing NM_026623
Red=Cloning site Green=Tags(s)

MSVVPPNRSQTGWPRGVNQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREE
FDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWV
IDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGP
IISSLPQLLSRFNFIYN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_026623
ORF Size 681 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026623.3, NP_080899.1
RefSeq Size 1111 bp
RefSeq ORF 684 bp
Locus ID 68219
UniProt ID Q9CQF3
Cytogenetics 8 C5
Summary Component of the cleavage factor Im (CFIm) complex that functions as an activator of the pre-mRNA 3'-end cleavage and polyadenylation processing required for the maturation of pre-mRNA into functional mRNAs. CFIm contributes to the recruitment of multiprotein complexes on specific sequences on the pre-mRNA 3'-end, so called cleavage and polyadenylation signals (pA signals). Most pre-mRNAs contain multiple pA signals, resulting in alternative cleavage and polyadenylation (APA) producing mRNAs with variable 3'-end formation. The CFIm complex acts as a key regulator of cleavage and polyadenylation site choice during APA through its binding to 5'-UGUA-3' elements localized in the 3'-untranslated region (UTR) for a huge number of pre-mRNAs. NUDT21/CPSF5 activates indirectly the mRNA 3'-processing machinery by recruiting CPSF6 and/or CPSF7. Binds to 5'-UGUA-3' elements localized upstream of pA signals that act as enhancers of pre-mRNA 3'-end processing. The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA (By similarity). Plays a role in somatic cell fate transitions and pluripotency by regulating widespread changes in gene expression through an APA-dependent function(PubMed:29249356). Binds to chromatin (PubMed:18032416). Binds to, but does not hydrolyze mono- and di-adenosine nucleotides (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Nudt21 (NM_026623) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC200256 Nudt21 (untagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 21 (Nudt21), (10ug) 10 ug
$300.00
MR202679 Nudt21 (Myc-DDK-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 21 (Nudt21) 10 ug
$289.00 MSRP $300.00 MSRP $300.00
MR202679L3 Lenti ORF clone of Nudt21 (Myc-DDK-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 21 (Nudt21) 10 ug
$600.00
MR202679L4 Lenti ORF clone of Nudt21 (mGFP-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 21 (Nudt21) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.