Tagln (NM_011526) Mouse Tagged ORF Clone

SKU
MG202069
Tagln (tGFP-tagged) - Mouse transgelin (Tagln)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tagln
Synonyms Sm2; Sm22; Sm22a; Ws310
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202069 representing NM_011526
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAACAAGGGTCCATCCTACGGCATGAGCCGAGAAGTGCAGTCCAAAATTGAGAAGAAGTATGACG
AGGAGCTGGAGGAGCGACTAGTGGAGTGGATTGTAGTGCAGTGTGGCCCTGATGTAGGCCGCCCAGATCG
TGGGCGCCTGGGCTTCCAGGTGTGGCTGAAGAATGGTGTGATTCTGAGCAAATTGGTGAACAGCCTGTAT
CCTGAGGGATCGAAGCCAGTGAAGGTGCCTGAGAACCCACCCTCCATGGTCTTTAAGCAGATGGAACAGG
TGGCTCAATTCTTGAAGGCAGCTGAAGATTATGGAGTCATCAAGACTGACATGTTCCAGACTGTTGACCT
CTATGAAGGTAAGGATATGGCAGCAGTGCAGAGGACTCTAATGGCTTTGGGCAGTTTGGCTGTGACCAAA
AACGATGGAAACTACCGTGGAGATCCCAACTGGTTTATGAAGAAAGCCCAGGAGCATAAGAGGGACTTCA
CAGACAGCCAACTGCAGGAGGGGAAGCACGTCATTGGCCTTCAAATGGGCAGCAACAGAGGAGCCTCGCA
GGCTGGCATGACAGGCTATGGGCGACCCCGGCAGATCATCAGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202069 representing NM_011526
Red=Cloning site Green=Tags(s)

MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIVVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLY
PEGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLYEGKDMAAVQRTLMALGSLAVTK
NDGNYRGDPNWFMKKAQEHKRDFTDSQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_011526
ORF Size 603 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011526.5
RefSeq Size 1429 bp
RefSeq ORF 606 bp
Locus ID 21345
UniProt ID P37804
Cytogenetics 9 25.36 cM
Summary This gene encodes a smooth muscle cell-specific cytoskeletal protein. The encoded protein is structurally similar to calponin, an actin-binding protein. In mouse models of atherosclerosis the gene product may be involved in plaque cell and atherosclerotic lesion formation during atherogenesis. [provided by RefSeq, Mar 2010]
Write Your Own Review
You're reviewing:Tagln (NM_011526) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC200529 Tagln (untagged) - Mouse transgelin (Tagln), (10ug) 10 ug
$450.00
MR202069 Tagln (Myc-DDK-tagged) - Mouse transgelin (Tagln) 10 ug
$450.00
MR202069L3 Lenti ORF clone of Tagln (Myc-DDK-tagged) - Mouse transgelin (Tagln) 10 ug
$750.00
MR202069L4 Lenti ORF clone of Tagln (mGFP-tagged) - Mouse transgelin (Tagln) 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.