Nudt15 (NM_172527) Mouse Tagged ORF Clone

SKU
MG201427
Nudt15 (tGFP-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 15 (Nudt15)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nudt15
Synonyms 6530403O17; A730068G11Rik; MTH2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201427 representing NM_172527
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCTAACGCAGAGCCGAGGCGGCGGCCAGGAGTTGGGGTCGGCGTGGTGGTGCTGAGCTGCGAGC
ATCCTCGCTGCGTCCTTCTGGGGAAAAGGAAAGGATCGTTTGGAGCCGGCAGTTTCCAGCTTCCTGGGGG
CCATTTGGAATTCGGTGAGACCTGGGAAGAATGCGCTCAGAGAGAAACCTGGGAAGAAGCTGGGCTTCAC
CTGAAAAATGTGTGCTTTGCCTCCGTGGTAAATTCTTTTGTTGAGAAGGAGAATTACCATTATGTTACCA
TATTAATGAAAGGAGAGGTGGATATGACTCATGATTCGGAGCCGAGGAATATGGAGCCTGAAAAGAATGA
AAGTTGGGAGTGGGTTCCATGGGAAGAATTCCCTCCCTTAGACCAGCTTTTCTGGGCTCTCCGCTGTCTA
AAAGAGCAAGGTTATGACCCATTTAAAGAGGACCTGAACCACCTGGAAGGGTACCGAGGAGAGCACCTTG
AAAGGACCACGAAGACTCCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201427 representing NM_172527
Red=Cloning site Green=Tags(s)

MAANAEPRRRPGVGVGVVVLSCEHPRCVLLGKRKGSFGAGSFQLPGGHLEFGETWEECAQRETWEEAGLH
LKNVCFASVVNSFVEKENYHYVTILMKGEVDMTHDSEPRNMEPEKNESWEWVPWEEFPPLDQLFWALRCL
KEQGYDPFKEDLNHLEGYRGEHLERTTKTP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_172527
ORF Size 510 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_172527.3
RefSeq Size 2595 bp
RefSeq ORF 513 bp
Locus ID 214254
UniProt ID Q8BG93
Cytogenetics 14 D3
Summary May catalyze the hydrolysis of nucleoside triphosphates including dGTP, dTTP, dCTP, their oxidized forms like 8-oxo-dGTP and the prodrug thiopurine derivatives 6-thio-dGTP and 6-thio-GTP (PubMed:12767940). Could also catalyze the hydrolysis of some nucleoside diphosphate derivatives (By similarity). Hydrolyzes oxidized nucleosides triphosphates like 8-oxo-dGTP in vitro, but the specificity and efficiency towards these substrates are low. Therefore, the potential in vivo sanitizing role of this enzyme, that would consist in removing oxidatively damaged forms of nucleosides to prevent their incorporation into DNA, is unclear (PubMed:12767940). Through the hydrolysis of thioguanosine triphosphates may participate in the catabolism of thiopurine drugs (By similarity). May also have a role in DNA synthesis and cell cycle progression by stabilizing PCNA (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Nudt15 (NM_172527) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC212604 Nudt15 (untagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 15 (Nudt15), (10ug) 10 ug
$330.00
MR201427 Nudt15 (Myc-DDK-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 15 (Nudt15) 10 ug
$289.00 MSRP $300.00 MSRP $300.00
MR201427L3 Lenti ORF clone of Nudt15 (Myc-DDK-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 15 (Nudt15) 10 ug
$600.00
MR201427L4 Lenti ORF clone of Nudt15 (mGFP-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 15 (Nudt15) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.