Isg15 (NM_015783) Mouse Tagged ORF Clone

SKU
MG201242
Isg15 (tGFP-tagged) - Mouse ISG15 ubiquitin-like modifier (Isg15)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Isg15
Synonyms 100038882; G1p2; IGI15; IP17; Irfp; UCRP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201242 representing NM_015783
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTGGGACCTAAAGGTGAAGATGCTGGGGGGTAACGATTTCCTGGTGTCCGTGACTAACTCCATGA
CGGTGTCAGAACTGAAGAAGCAGATTGCCCAGAAGATTGGTGTGCCGGCTTTCCAGCAGCGCCTGGCCCA
CCAAACTGCAGTGCTCCAGGACGGTCTTACCCTTTCCAGTCTGGGTCTGGGTCCCAGCAGCACAGTGATG
CTAGTGGTACAGAACTGCAGCGAGCCTCTGAGCATCCTGGTGAGGAACGAAAGGGGCCACAGCAACATCT
ATGAGGTCTTTCTGACGCAGACTGTAGACACGCTTAAGAAGAAGGTGTCCCAGCGGGAACAAGTCCACGA
AGACCAGTTCTGGCTGAGCTTCGAGGGAAGGCCCATGGAGGACAAGGAGCTGCTGGGGGAGTATGGCCTA
AAGCCCCAGTGCACAGTGATCAAGCATTTGCGCCTGAGGGGTGGGGGAGGGGACCAGTGTGCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201242 representing NM_015783
Red=Cloning site Green=Tags(s)

MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVM
LVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGL
KPQCTVIKHLRLRGGGGDQCA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_015783
ORF Size 483 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015783.3, NP_056598.2
RefSeq Size 728 bp
RefSeq ORF 486 bp
Locus ID 100038882
UniProt ID Q64339
Cytogenetics 4
Summary Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein (ISGylation) or via its action as a free or unconjugated protein. ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein. Its target proteins include SERPINA3G/SPI2A, JAK1, MAPK3/ERK1, PLCG1, TRIM25, STAT5A, MAPK1/ERK2 and globin. Can also isgylate: DDX58/RIG-I which inhibits its function in antiviral signaling response and EIF4E2 which enhances its cap structure-binding activity and translation-inhibition activity. Exhibits antiviral activity towards both DNA and RNA viruses, including influenza A and B virus, sindbis virus (SV) and herpes simplex type-1 (HHV-1). Plays a significant role in the control of neonatal Chikungunya virus (CHIKV) infection by acting as a putative immunomodulator of proinflammatory cytokines. Protects mice against the consequences of Chikungunya virus infection by downregulating the pathogenic cytokine response, often denoted as the cytokine storm. Plays a role in erythroid differentiation. The secreted form of ISG15 can: induce natural killer cell proliferation, act as a chemotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity. The secreted form acts through the integrin ITGAL/ITGB2 receptor to initiate activation of SRC family tyrosine kinases including LYN, HCK and FGR which leads to secretion of IFNG and IL10; the interaction is mediated by ITGAL (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Isg15 (NM_015783) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC201434 Isg15 (untagged) - Mouse ISG15 ubiquitin-like modifier (Isg15), (10ug) 10 ug
$150.00
MC207985 Isg15 (untagged) - Mouse ISG15 ubiquitin-like modifier (Isg15), (10ug) 10 ug
$165.00
MR201242 Isg15 (Myc-DDK-tagged) - Mouse ISG15 ubiquitin-like modifier (Isg15) 10 ug
$289.00
MR201242L3 Lenti ORF clone of Isg15 (Myc-DDK-tagged) - Mouse ISG15 ubiquitin-like modifier (Isg15) 10 ug
$450.00
MR201242L4 Lenti ORF clone of Isg15 (mGFP-tagged) - Mouse ISG15 ubiquitin-like modifier (Isg15) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.