Prelid1 (BC024813) Mouse Tagged ORF Clone

SKU
MG201166
Prelid1 (tGFP-tagged) - Mouse PRELI domain containing 1 (cDNA clone MGC:35734 IMAGE:5356044)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$365.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Prelid1
Synonyms 2610524G07Rik; Preli
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201166 representing BC024813
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCACGTTGGGCAGAGCGACTGTTTCCTGCCAACGTTGCTCACTCCGTGTACATCCTGGAGGACTCTA
TTGTGGACCCCCAGAATCAGACCATGACCACCTTCACCTGGAACATCAACCATGCCCGGCTGATGGTGGT
GGAGGAACGATGTGTTTACTGTGTGAACTCTGACAATAGCGGCTGGACCGAAATCCGTCGGGAAGCCTGG
GTCTCCTCTAGCTTATTTGGCGTCTCCAGAGCTGTCCAGGAATTTGGTCTTGCCCGGTTCAAAAGCAATG
TGACCAAGACAATGAAGGGCTTTGAATACATCCTGGCCAAGCTACAAGGTGAGGCCCCTTCCAAAACCCT
TGTTGAGACAGCCAAAGAGGCCAAAGAGAAAGCAAAGGAGACCGCACTGGCAGCTACAGAGAAGGCCAAG
GACCTGGCCAACAAGGCCGCCACCAAGCAGCAGCAGCGGCAGCTCGTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201166 representing BC024813
Red=Cloning site Green=Tags(s)

MPRWAERLFPANVAHSVYILEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRREAW
VSSSLFGVSRAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKTLVETAKEAKEKAKETALAATEKAK
DLANKAATKQQQRQLV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN BC024813
ORF Size 468 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC024813, AAH24813
RefSeq Size 899 bp
RefSeq ORF 470 bp
Locus ID 66494
Cytogenetics 13 B1
Summary Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Regulates the mitochondrial apoptotic pathway in primary Th cells. Regulates Th cell differentiation by down-regulating STAT6 thereby reducing IL-4-induced Th2 cell number. May be important for the development of vital and immunocompetent organs (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Prelid1 (BC024813) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MR201166 Prelid1 (Myc-DDK-tagged) - Mouse PRELI domain containing 1 (cDNA clone MGC:35734 IMAGE:5356044) 10 ug
$165.00
MR201166L3 Lenti ORF clone of Prelid1 (Myc-DDK-tagged) - Mouse PRELI domain containing 1 (cDNA clone MGC:35734 IMAGE:5356044) 10 ug
$465.00
MR201166L4 Lenti ORF clone of Prelid1 (mGFP-tagged) - Mouse PRELI domain containing 1 (cDNA clone MGC:35734 IMAGE:5356044) 10 ug
$465.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.