Ttr (NM_013697) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG200992
Ttr (tGFP-tagged) - Mouse transthyretin (Ttr)
  $489.00
In Stock*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ttr
Synonyms AA408768; AI787086; D17860; prea; prealbumin
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200992 representing NM_013697
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCCCTTCGACTCTTCCTCCTTTGCCTCGCTGGACTGGTATTTGTGTCTGAAGCTGGCCCCGCGG
GTGCTGGAGAATCCAAATGTCCTCTGATGGTCAAAGTCCTGGATGCTGTCCGAGGCAGCCCTGCTGTAGA
CGTGGCTGTAAAAGTGTTCAAAAAGACCTCTGAGGGATCCTGGGAGCCCTTTGCCTCTGGGAAGACCGCG
GAGTCTGGAGAGCTGCACGGGCTCACCACAGATGAGAAGTTTGTAGAAGGAGTGTACAGAGTAGAACTGG
ACACCAAATCGTACTGGAAGACACTTGGCATTTCCCCGTTCCATGAATTCGCGGATGTGGTTTTCACAGC
CAACGACTCTGGCCATCGCCACTACACCATCGCAGCCCTGCTCAGCCCATACTCCTACAGCACCACGGCT
GTCGTCAGCAACCCCCAGAAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200992 representing NM_013697
Red=Cloning site Green=Tags(s)

MASLRLFLLCLAGLVFVSEAGPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTA
ESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTA
VVSNPQN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_013697
ORF Size 441 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013697.5
RefSeq Size 1052 bp
RefSeq ORF 444 bp
Locus ID 22139
UniProt ID P07309
Cytogenetics 18 11.47 cM
Summary This gene encodes a carrier protein responsible for the transport of thyroid hormones and retinol. The protein consists of a tetramer of identical subunits. Due to increased stability of the tetramer form of this encoded protein in mouse, compared to the human protein, this gene product has a reduced tendency to form amyloid fibrils. In humans, this protein binds beta-amyloid preventing its aggregation and providing a neuroprotective role in Alzheimer's disease. provided by RefSeq, Mar 2010
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_013697" in other vectors (4)
SKU Description Size Price
MC203140 Ttr (untagged) - Mouse transthyretin (Ttr), (10ug) 10 ug
$300.00
MR200992 Ttr (Myc-DDK-tagged) - Mouse transthyretin (Ttr) 10 ug
$289.00
MR200992L3 Lenti ORF clone of Ttr (Myc-DDK-tagged) - Mouse transthyretin (Ttr) 10 ug
$450.00
MR200992L4 Lenti ORF clone of Ttr (mGFP-tagged) - Mouse transthyretin (Ttr) 10 ug
$450.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.