Pop7 (NM_028753) Mouse Tagged ORF Clone

SKU
MG200880
Pop7 (tGFP-tagged) - Mouse processing of precursor 7, ribonuclease P family, (S
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Pop7
Synonyms 0610037N12Rik; AI852017; Rpp20
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200880 representing NM_028753
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAAAACAGAGAACCCCGCTGTGCCATCGAGGCTGAGCTGGACCCTGTGGAGTACACCCTTCGGA
AGCGACTTCCCCACCGCTTGCCCCGGAGGCCCAACGACATTTATGTCAACATGAAGACTGACTTTAAGGC
CCAGCTAGCTCGCTGCCAAAAGCTCCTGGACGGAGGCACTAGGGGGCAGAACGCATGCACTGAAATCTAC
ATTCATGGCTTGGGCCTGGCCATCAACCGGGCCATCAACATCGCCCTGCAGCTGCAGGCGGGCAGCTTTG
GGTCCCTACAGGTGGCCGCCAATACCTCCACCGTGGAGCTGGTGGACGAGTTGGAGCCAGAGACTGACTC
TCGGGAGCCCCTGACGAGGGTCAGGAACAACTCAGCCATCCACATCCGAGTCTTCAGGGTCACGCCCAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200880 representing NM_028753
Red=Cloning site Green=Tags(s)

MAENREPRCAIEAELDPVEYTLRKRLPHRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGTRGQNACTEIY
IHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDSREPLTRVRNNSAIHIRVFRVTPK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_028753
ORF Size 420 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_028753.2
RefSeq Size 794 bp
RefSeq ORF 423 bp
Locus ID 74097
UniProt ID Q9DCH2
Cytogenetics 5 G2
Summary Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Pop7 (NM_028753) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC201165 Pop7 (untagged) - Mouse processing of precursor 7, ribonuclease P family, (S. cerevisiae) (Pop7), (10ug) 10 ug
$150.00
MR200880 Pop7 (Myc-DDK-tagged) - Mouse processing of precursor 7, ribonuclease P family, (S. cerevisiae) (Pop7) 10 ug
$289.00
MR200880L3 Lenti ORF clone of Pop7 (Myc-DDK-tagged) - Mouse processing of precursor 7, ribonuclease P family, (S. cerevisiae) (Pop7) 10 ug
$450.00
MR200880L4 Lenti ORF clone of Pop7 (mGFP-tagged) - Mouse processing of precursor 7, ribonuclease P family, (S. cerevisiae) (Pop7) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.