Tax1bp3 (BC094314) Mouse Tagged ORF Clone

SKU
MG200632
Tax1bp3 (tGFP-tagged) - Mouse Tax1 (human T-cell leukemia virus type I) binding protein 3 (cDNA clone MGC:106646 IMAGE:5715687), complete
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tax1bp3
Synonyms TIP-1, RP23-263M10.10
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200632 representing BC094314
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTACACCCCGGGCCAGCCTGTCACCGCCGTAGTGCAAAGAGTTGAAATTCATAAGTTGCGTCAAG
GTGAGAACTTAATCTTGGGCTTCAGTATTGGAGGTGGGATCGACCAGGACCCGTCTCAGAATCCCTTCTC
GGAAGATAAAACAGACAAGGGCATTTACGTCACACGAGTATCAGAGGGAGGTCCTGCTGAAATTGCTGGG
CTGCAGATTGGAGACAAGATCATGCAGGTGAATGGCTGGGACATGACCATGGTCACTCACGACCAGGCTC
GGAAGCGGCTCACCAAGCGCTCGGAGGAGGTGGTCCGCCTGCTGGTGACTCGGCAGTCTCTACAAAAGGC
TGTACAGCAGTCCATGCTGTCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200632 representing BC094314
Red=Cloning site Green=Tags(s)

MSYTPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAG
LQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN BC094314
ORF Size 372 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC094314, AAH94314
RefSeq Size 1277 bp
RefSeq ORF 374 bp
Locus ID 76281
Cytogenetics 11 B4
Summary May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Tax1bp3 (BC094314) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC206961 Tax1bp3 (untagged) - Mouse Tax1 (human T-cell leukemia virus type I) binding protein 3 (cDNA clone MGC:106646 IMAGE:5715687), complete, (10ug) 10 ug
$165.00
MR200632 Tax1bp3 (Myc-DDK-tagged) - Mouse Tax1 (human T-cell leukemia virus type I) binding protein 3 (cDNA clone MGC:106646 IMAGE:5715687), complete 10 ug
$289.00
MR200632L3 Lenti ORF clone of Tax1bp3 (Myc-DDK-tagged) - Mouse Tax1 (human T-cell leukemia virus type I) binding protein 3 (cDNA clone MGC:106646 IMAGE:5715687), complete 10 ug
$450.00
MR200632L4 Lenti ORF clone of Tax1bp3 (mGFP-tagged) - Mouse Tax1 (human T-cell leukemia virus type I) binding protein 3 (cDNA clone MGC:106646 IMAGE:5715687), complete 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.