Eif4ebp1 (NM_007918) Mouse Tagged ORF Clone

SKU
MG200530
Eif4ebp1 (tGFP-tagged) - Mouse eukaryotic translation initiation factor 4E binding protein 1 (Eif4ebp1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Eif4ebp1
Synonyms 4e-bp1; AA959816; PHAS-I
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200530 representing NM_007918
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGCGGGCAGCAGCTGCAGCCAGACTCCCAGCCGGGCCATCCCCACTCGCCGCGTAGCCCTCGGCG
ATGGCGTGCAGCTCCCGCCCGGGGACTACAGCACCACTCCGGGCGGCACGCTCTTCAGCACCACCCCGGG
AGGAACCAGGATTATCTATGACCGGAAATTTCTGATGGAGTGTCGGAACTCACCTGTGGCCAAAACACCC
CCAAAGGACCTGCCAGCCATTCCTGGGGTCACTAGCCCTACCAGCGATGAGCCTCCCATGCAAGCCAGCC
AGAGCCAACTGCCCAGCAGCCCGGAAGATAAGCGGGCAGGCGGTGAAGAGTCACAATTTGAGATGGACAT
T


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200530 representing NM_007918
Red=Cloning site Green=Tags(s)

MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTP
PKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKRAGGEESQFEMDI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007918
ORF Size 351 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007918.3, NP_031944.3
RefSeq Size 981 bp
RefSeq ORF 354 bp
Locus ID 13685
UniProt ID Q60876
Cytogenetics 8 15.95 cM
Summary Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation (By similarity). Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways (PubMed:7629182).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Eif4ebp1 (NM_007918) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC200374 Eif4ebp1 (untagged) - Mouse eukaryotic translation initiation factor 4E binding protein 1 (Eif4ebp1), (10ug) 10 ug
$150.00
MR200530 Eif4ebp1 (Myc-DDK-tagged) - Mouse eukaryotic translation initiation factor 4E binding protein 1 (Eif4ebp1) 10 ug
$289.00
MR200530L3 Lenti ORF clone of Eif4ebp1 (Myc-DDK-tagged) - Mouse eukaryotic translation initiation factor 4E binding protein 1 (Eif4ebp1) 10 ug
$450.00
MR200530L4 Lenti ORF clone of Eif4ebp1 (mGFP-tagged) - Mouse eukaryotic translation initiation factor 4E binding protein 1 (Eif4ebp1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.