Gng11 (NM_025331) Mouse Tagged ORF Clone

SKU
MG200085
Gng11 (tGFP-tagged) - Mouse guanine nucleotide binding protein (G protein), gamma 11 (Gng11)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Gng11
Synonyms 0610037B21Rik
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200085 representing NM_025331
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGCCCTTCACATCGAGGATCTGCCGGAAAAGGAAAAACTGAAGATGGAGGTTGAGCAACTTCGCA
AAGAAGTCAAGTTGCAGAGACAACAGGTATCTAAATGTTCTGAGGAAATAAAGAACTACATTGAAGAACG
TTCTGGAGAGGATCCTCTGGTAAAGGGAATCCCAGAAGACAAGAATCCCTTCAAAGAAAAGGGCAGCTGT
GTCATTTCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200085 representing NM_025331
Red=Cloning site Green=Tags(s)

MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSC
VIS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_025331
ORF Size 219 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025331.2, NP_079607.1
RefSeq Size 849 bp
RefSeq ORF 222 bp
Locus ID 66066
UniProt ID P61953
Cytogenetics 6 A1
Summary Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Gng11 (NM_025331) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC201520 Gng11 (untagged) - Mouse guanine nucleotide binding protein (G protein), gamma 11 (Gng11), (10ug) 10 ug
$150.00
MR200085 Gng11 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), gamma 11 (Gng11) 10 ug
$289.00
MR200085L3 Lenti ORF clone of Gng11 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), gamma 11 (Gng11) 10 ug
$450.00
MR200085L4 Lenti ORF clone of Gng11 (mGFP-tagged) - Mouse guanine nucleotide binding protein (G protein), gamma 11 (Gng11) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.