Mouse Pdx1 (NM_008814) AAV Particle

SKU
MR227421A1V
AAV ORF Particles, serotype AAV-2, Pdx1 (Myc-DDK-tagged) - Mouse pancreatic and duodenal homeobox 1 (Pdx1), 250ul, >10^13 GC/mL
  • AAV ORF®

$850.00
4 Weeks*
Specifications
Product Data
Tag Myc-DDK
Target Symbol Pdx1
Synonyms IDX-1; IPF-1; Ipf1; Mody4; pdx-1; STF-1
Vector pAAV-AC-Myc-DDK
Mammalian Cell Selection None
Sequence Data
ORF Nucleotide Sequence
>MR227421 representing NM_008814
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC



AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR227421 representing NM_008814
Red=Cloning site Green=Tags(s)



SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Species Mouse
Serotype AAV-2
ACCN NM_008814
ORF Size 852 bp
Buffer PBS with 0.001% Pluronic F68
Stability AAV is stable for 1 year when stored at -80°C (long-term storage) or 2-3 weeks when stored at -20°C (short-term storage). Thaw the vial of AAV on ice prior to use and keep it on ice during the experiment. Thawed AAV can be stored at 4°C for 1-2 weeks. Whenever possible, particles should be aliquoted into single use portions to avoid repeated freeze/thaw cycles. Please aliquot at least 10ul per tube and use low protein binding tubes to avoid loss of virus.
Shipping Dry Ice
Reference Data
RefSeq NM_008814.3
RefSeq Size 1287 bp
RefSeq ORF 855 bp
Locus ID 18609
UniProt ID P52946
Cytogenetics 5 86.84 cM
MW 31.4 kDa
Write Your Own Review
You're reviewing:Mouse Pdx1 (NM_008814) AAV Particle
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.