Frizzled 10 (FZD10) Rabbit Polyclonal Antibody

SKU TA356128

FZD10 Antibody

Product Data

• Application: IF
• Reactivity: Human
• Antibody Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
• Specificity: Expected reactivity: Cow, Dog, Horse, Human, Mouse, Pig; Homology: Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 100%
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Stability: Shelf life: one year from despatch.
• Shipping: Blue Ice
• Predicted Protein Size: 65 kDa
• Gene Name: frizzled class receptor 10
• Database Link:
  NP_009128
  Q9ULW2
• Background: This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
• Synonyms: CD350; FZ-10; FzE7; hFz10

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Basal cell carcinoma, Colorectal cancer, Melanogenesis, Pathways in cancer, Wnt signaling pathway