Frizzled 10 (FZD10) Rabbit Polyclonal Antibody

SKU TA344071

Rabbit Polyclonal Anti-FZD10 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the N terminal of human FZD10. Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 65 kDa
• Gene Name: frizzled class receptor 10
• Database Link:
  NP_009128
  Q9ULW2
• Background: FZD10 is a member of the frizzled family. Members of this family are 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
• Synonyms: CD350; FZ-10; Fz10; FzE7; hFz10
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Basal cell carcinoma, Colorectal cancer, Melanogenesis, Pathways in cancer, Wnt signaling pathway