C3orf39 (POMGNT2) Rabbit Polyclonal Antibody

SKU TA346854

Rabbit Polyclonal Anti-C3orf39 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C3orf39 antibody: synthetic peptide directed towards the middle region of human C3orf39. Synthetic peptide located within the following region: TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 66 kDa
• Gene Name: protein O-linked mannose N-acetylglucosaminyltransferase 2 (beta 1,4-)
• Database Link:
  NP_116195
  Q8NAT1
• Background: This gene encodes a protein with glycosyltransferase activity although its function is not currently known. [provided by RefSeq, Sep 2012]
• Synonyms: AGO61; C3orf39; GTDC2; MDDGA8
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data