SLC14A1 Rabbit Polyclonal Antibody

SKU TA346523

Rabbit Polyclonal Anti-SLC14A1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC14A1 antibody: synthetic peptide directed towards the C terminal of human SLC14A1. Synthetic peptide located within the following region: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: solute carrier family 14 member 1 (Kidd blood group)
• Database Link:
  NP_056949
  Q13336
• Background: The protein encoded by this gene is a membrane transporter that mediates urea transport in erythrocytes. This gene forms the basis for the Kidd blood group system. [provided by RefSeq, Mar 2009]
• Synonyms: HsT1341; HUT11; JK; RACH1; RACH2; UT-B1; UT1; UTE
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Goat: 93%; Sheep: 93%; Bovine: 86%; Horse: 83%; Mouse: 83%

Reference Data

• Protein Families: Transmembrane