REC8 Rabbit Polyclonal Antibody

SKU
TA346502
Rabbit Polyclonal Anti-REC8 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-REC8 antibody: synthetic peptide directed towards the N terminal of human REC8. Synthetic peptide located within the following region: QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 62 kDa
Gene Name REC8 meiotic recombination protein
Database Link
Background This gene encodes a member of the kleisin family of SMC (structural maintenance of chromosome) protein partners. The protein localizes to the axial elements of chromosomes during meiosis in both oocytes and spermatocytes. In the mouse, the homologous protein is a key component of the meiotic cohesion complex, which regulates sister chromatid cohesion and recombination between homologous chromosomes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008]
Synonyms HR21spB; REC8L1; Rec8p
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 93%
Reference Data
Protein Pathways Oocyte meiosis
Write Your Own Review
You're reviewing:REC8 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.