Uridine Phosphorylase 1 (UPP1) Rabbit Polyclonal Antibody

CAT#: TA346356

Rabbit Polyclonal Anti-UPP1 Antibody

Product Images

WB Suggested Anti-UPP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UPP1 antibody: synthetic peptide directed towards the middle region of human UPP1. Synthetic peptide located within the following region: ACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: uridine phosphorylase 1
• Database Link:
  NP_003355
  Entrez Gene 7378 Human
  UniProt ID Q16831
• Background: UPP1 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
• Synonyms: UDRPASE; UP; UPASE; UPP
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Zebrafish: 100%; Dog: 92%; Pig: 85%; Rat: 85%; Horse: 85%; Mouse: 85%; Guinea pig: 85%; Rabbit: 77%

Reference Data

• Protein Pathways: Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism