Protein C (PROC) Rabbit Polyclonal Antibody

SKU
TA346174
Rabbit Polyclonal Anti-PROC Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PROC antibody: synthetic peptide directed towards the middle region of human PROC. Synthetic peptide located within the following region: PCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLD
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 52 kDa
Gene Name protein C, inactivator of coagulation factors Va and VIIIa
Database Link
Background Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids.
Synonyms APC; PC; PROC1; THPH3; THPH4
Note Immunogen Sequence Homology: Human: 100%; Horse: 79%
Reference Data
Protein Families Druggable Genome, Protease
Protein Pathways Complement and coagulation cascades
Write Your Own Review
You're reviewing:Protein C (PROC) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.