CUG BP1 (CELF1) Rabbit Polyclonal Antibody

SKU TA345754

Rabbit Polyclonal Anti-CUGBP1 Antibody

Product Data

• Application: IHC
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CUGBP1 antibody: synthetic peptide directed towards the N terminal of human CUGBP1. Synthetic peptide located within the following region: QMKPADSEKNNVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: CUGBP, Elav-like family member 1
• Database Link:
  NP_001166110
  Q92879
• Background: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene.
• Synonyms: BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome