MAGP1 (MFAP2) Rabbit Polyclonal Antibody

SKU TA345001

Rabbit Polyclonal Anti-MFAP2 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MFAP2 antibody: synthetic peptide directed towards the N terminal of human MFAP2. Synthetic peptide located within the following region: MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 19 kDa
• Gene Name: microfibrillar associated protein 2
• Database Link:
  NP_059453
  P55001
• Background: Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for
• Synonyms: MAGP; MAGP-1; MAGP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Guinea pig: 92%

Reference Data

• Protein Families: Secreted Protein