TFEB Rabbit Polyclonal Antibody

SKU
TA344452
Rabbit Polyclonal Anti-TFEB Antibody - middle region
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TFEB antibody: synthetic peptide directed towards the middle region of human TFEB. Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 53 kDa
Gene Name transcription factor EB
Database Link
Background The TFEB gene fuses with an intronless gene in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation. It encodes a protein that is a highly sensitive and specific diagnostic marker for renal neoplasms.
Synonyms ALPHATFEB; BHLHE35; TCFEB
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rabbit: 86%; Horse: 85%; Goat: 79%; Bovine: 79%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:TFEB Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.