COQ9 Rabbit Polyclonal Antibody

SKU TA343301

Rabbit Polyclonal Anti-COQ9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-COQ9 antibody is: synthetic peptide directed towards the N-terminal region of COQ9. Synthetic peptide located within the following region: AFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: coenzyme Q9
• Database Link:
  NP_064708
  O75208
• Background: This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency.
• Synonyms: C16orf49; COQ10D5
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 90%; Guinea pig: 90%; Rabbit: 86%; Rat: 83%

Reference Data

• Protein Families: Druggable Genome