CYP2A7 Rabbit Polyclonal Antibody

SKU
TA341978
Rabbit Polyclonal Anti-TMEM158 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TMEM158 antibody: synthetic peptide directed towards the middle region of human TMEM158. Synthetic peptide located within the following region: AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 30 kDa
Gene Name cytochrome P450 family 2 subfamily A member 7
Database Link
Background Constitutive activation ofThe Ras pathway triggers an irreversible proliferation arrest reminiscent of replicative senescence. Transcription ofThis gene is upregulated in response to activation ofThe Ras pathway, but not under other conditions that induce senescence.The encoded protein is similar to a rat cell surface receptor proposed to function in a neuronal survival pathway. [provided by RefSeq, Jul 2008]
Synonyms CPA7; CPAD; CYP2A; CYPIIA7; P450-IIA4
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%
Reference Data
Protein Families Druggable Genome, P450, Transmembrane
Protein Pathways Caffeine metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Retinol metabolism
Write Your Own Review
You're reviewing:CYP2A7 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.