ADAR1 (ADAR) Rabbit Polyclonal Antibody

SKU TA341713

Rabbit Polyclonal Anti-ADAR Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADAR antibody: synthetic peptide directed towards the C terminal of human ADAR. Synthetic peptide located within the following region: RMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAMLSHR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 136 kDa
• Gene Name: adenosine deaminase, RNA-specific
• Database Link:
  NP_001102
  P55265
• Background: This gene encodes a protein that sorts transmembrane proteins into lysosomes/vacuoles viaThe multivesicular body (MVB) pathway.This protein, along with other soluble coiled-coil containing proteins, forms part ofThe ESCRT-III protein complex that binds toThe endosomal membrane and recruits additional cofactors for protein sorting intoThe MVB.This protein may also co-immunoprecipitate with a member ofThe IFG-binding protein superfamily. Alternative splicing results in multiple transcript variants. Read-through transcription also exists betweenThis gene andThe upstream ring finger protein 103 (RNF103) gene. [provided by RefSeq, Nov 2010]
• Synonyms: ADAR1; AGS6; DRADA; DSH; DSRAD; G1P1; IFI-4; IFI4; K88DSRBP; P136
• Note: Immunogen Sequence Homology: Rat: 100%; Pig: 92%; Horse: 92%; Human: 92%; Rabbit: 92%; Guinea pig: 92%; Mouse: 91%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Cytosolic DNA-sensing pathway