DIRAS1 Rabbit Polyclonal Antibody

SKU TA340389

Rabbit Polyclonal Anti-DIRAS1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DIRAS1 antibody: synthetic peptide directed towards the N terminal of human DIRAS1. Synthetic peptide located within the following region: PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 22 kDa
• Gene Name: DIRAS family GTPase 1
• Database Link:
  NP_660156
  O95057
• Background: DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases.DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases. [supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3390 BC030660.1 2-3391
• Synonyms: Di-Ras1; GBTS1; RIG
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 93%; Yeast: 91%; Sheep: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data