LRG1 Rabbit Polyclonal Antibody

SKU TA340226

Rabbit Polyclonal Anti-LRG1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LRG1 antibody: synthetic peptide directed towards the N terminal of human LRG1. Synthetic peptide located within the following region: GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: leucine-rich alpha-2-glycoprotein 1
• Database Link:
  NP_443204
  P02750
• Background: The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]).
• Synonyms: HMFT1766; LRG
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 79%; Bovine: 79%

Reference Data

• Protein Families: Secreted Protein