HNF1 alpha (HNF1A) Rabbit Polyclonal Antibody

SKU
TA339211
Rabbit Polyclonal Anti-HNF1A
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 67 kDa
Gene Name HNF1 homeobox A
Database Link
Background HNF1A is required for the expression of several liver specific genes. HNF1A binds to the inverted palindrome 5'-GTTAATNATTAAC-3'.
Synonyms HNF-1A; HNF1; IDDM20; LFB1; MODY3; TCF-1; TCF1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Categories Cancer: Bladder, Diabetes, Intracellular Proteins
Protein Families Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Protein Pathways Maturity onset diabetes of the young
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.