ZNF213 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF213 antibody: synthetic peptide directed towards the middle region of human ZNF213. Synthetic peptide located within the following region: EWGTLDPAQRDLFWDIKRENSRNTTLGFGLKGQSEKSLLQEMVPVVPGQT |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 51 kDa |
Gene Name | zinc finger protein 213 |
Database Link | |
Background | C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression. [supplied by OMIM, Apr 2004]. Transcript Variant: This variant (2) uses an alternate donor splice site at the first exon, hence has a different 5' UTR compared to variant 1. Transcript variants 1 and 2 encode the same protein. ##Evidence-Data-START## Transcript exon combination :: AK289834.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025083, ERS025087 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. |
Synonyms | CR53; ZKSCAN21; ZSCAN53 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Transcription Factors |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.