NPEPL1 Rabbit Polyclonal Antibody

SKU TA337470

Rabbit Polyclonal Anti-NPEPL1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NPEPL1 antibody is: synthetic peptide directed towards the N-terminal region of Human NPEPL1. Synthetic peptide located within the following region: CIVMVCEQPEVFASACALARAFPLFTHRSGASRRLEKKTVTVEFFLVGQD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: aminopeptidase-like 1
• Database Link:
  NP_078939
  Q8NDH3
• Background: NPEPL1 probably catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.
• Synonyms: bA261P9.2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Protease